DC900062

Overview
NameDC900062
Unique NameDC900062
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length403
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5633 contig Csv1_Contig5633:1..403. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS1_ARATH (Pre-mRNA-splicing factor SF2 OS=Arabidopsis thaliana GN=SF2 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 3.276e-30
Identity = 61/83 (73.49%), Postives = 69/83 (83.13%), Query Frame = 2
Query:  137 MSGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGG 385
            MS R S  +Y GNLP DIRE EVEDLF KYG ++ I+LK+PPRPP Y FVEF++ARDAEDAI GRDGY+FDG RLRVELAHGG
Sbjct:    1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGG 83          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: RSP3_CAEEL (Probable splicing factor, arginine/serine-rich 3 OS=Caenorhabditis elegans GN=rsp-3 PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 9.554e-22
Identity = 48/80 (60.00%), Postives = 59/80 (73.75%), Query Frame = 2
Query:  161 IYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRGP 400
            +Y GNLP D+RE EVED+F+KYGRI  +++K   R P + FVEFE+ RDAEDA+R RDGY FDG R+RVE   G   RGP
Sbjct:   11 VYVGNLPGDVREKEVEDIFHKYGRIKYVDIK-SGRGPAFAFVEFEDHRDAEDAVRARDGYEFDGRRIRVEFTRGVGPRGP 89          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS1_XENTR (Splicing factor, arginine/serine-rich 1 OS=Xenopus tropicalis GN=sfrs1 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.630e-21
Identity = 49/86 (56.98%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  140 SGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            +G     IY GNLP DIR  ++ED+FYKYG I DI+LK     P + FVEFE+ RDAEDA+ GRDGY++DG RLRVE    G G G
Sbjct:   11 AGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGAG 96          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS1_PONAB (Splicing factor, arginine/serine-rich 1 OS=Pongo abelii GN=SFRS1 PE=2 SV=3)

HSP 1 Score: 101.293 bits (251), Expect = 1.630e-21
Identity = 49/86 (56.98%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  140 SGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            +G     IY GNLP DIR  ++ED+FYKYG I DI+LK     P + FVEFE+ RDAEDA+ GRDGY++DG RLRVE    G G G
Sbjct:   11 AGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTG 96          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS1_PIG (Splicing factor, arginine/serine-rich 1 OS=Sus scrofa GN=SFRS1 PE=2 SV=3)

HSP 1 Score: 101.293 bits (251), Expect = 1.630e-21
Identity = 49/86 (56.98%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  140 SGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            +G     IY GNLP DIR  ++ED+FYKYG I DI+LK     P + FVEFE+ RDAEDA+ GRDGY++DG RLRVE    G G G
Sbjct:   11 AGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTG 96          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS1_MOUSE (Splicing factor, arginine/serine-rich 1 OS=Mus musculus GN=Sfrs1 PE=1 SV=3)

HSP 1 Score: 101.293 bits (251), Expect = 1.630e-21
Identity = 49/86 (56.98%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  140 SGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            +G     IY GNLP DIR  ++ED+FYKYG I DI+LK     P + FVEFE+ RDAEDA+ GRDGY++DG RLRVE    G G G
Sbjct:   11 AGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTG 96          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS1_HUMAN (Splicing factor, arginine/serine-rich 1 OS=Homo sapiens GN=SFRS1 PE=1 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 1.630e-21
Identity = 49/86 (56.98%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  140 SGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            +G     IY GNLP DIR  ++ED+FYKYG I DI+LK     P + FVEFE+ RDAEDA+ GRDGY++DG RLRVE    G G G
Sbjct:   11 AGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTG 96          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS1_CHICK (Splicing factor, arginine/serine-rich 1 OS=Gallus gallus GN=SFRS1 PE=1 SV=3)

HSP 1 Score: 101.293 bits (251), Expect = 1.630e-21
Identity = 49/86 (56.98%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  140 SGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            +G     IY GNLP DIR  ++ED+FYKYG I DI+LK     P + FVEFE+ RDAEDA+ GRDGY++DG RLRVE    G G G
Sbjct:   11 AGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTG 96          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS1_BOVIN (Splicing factor, arginine/serine-rich 1 OS=Bos taurus GN=SFRS1 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.630e-21
Identity = 49/86 (56.98%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  140 SGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            +G     IY GNLP DIR  ++ED+FYKYG I DI+LK     P + FVEFE+ RDAEDA+ GRDGY++DG RLRVE    G G G
Sbjct:   11 AGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTG 96          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFR1B_DANRE (Splicing factor, arginine/serine-rich 1B OS=Danio rerio GN=sfrs1b PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.630e-21
Identity = 50/86 (58.14%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  140 SGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            +G     IY GNLP DIR  +VED+FYKYG I DI+LK     P + FVEFE+ RDAEDA+ GRDGY++DG RLRVE    G G G
Sbjct:   10 AGNNDCRIYVGNLPPDIRTKDVEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGGG 95          
The following BLAST results are available for this feature:
BLAST of DC900062 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
SFRS1_ARATH3.276e-3073.49Pre-mRNA-splicing factor SF2 OS=Arabidopsis thalia... [more]
RSP3_CAEEL9.554e-2260.00Probable splicing factor, arginine/serine-rich 3 O... [more]
SFRS1_XENTR1.630e-2156.98Splicing factor, arginine/serine-rich 1 OS=Xenopus... [more]
SFRS1_PONAB1.630e-2156.98Splicing factor, arginine/serine-rich 1 OS=Pongo a... [more]
SFRS1_PIG1.630e-2156.98Splicing factor, arginine/serine-rich 1 OS=Sus scr... [more]
SFRS1_MOUSE1.630e-2156.98Splicing factor, arginine/serine-rich 1 OS=Mus mus... [more]
SFRS1_HUMAN1.630e-2156.98Splicing factor, arginine/serine-rich 1 OS=Homo sa... [more]
SFRS1_CHICK1.630e-2156.98Splicing factor, arginine/serine-rich 1 OS=Gallus ... [more]
SFRS1_BOVIN1.630e-2156.98Splicing factor, arginine/serine-rich 1 OS=Bos tau... [more]
SFR1B_DANRE1.630e-2158.14Splicing factor, arginine/serine-rich 1B OS=Danio ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900062 VSS Citrus sinensis cDNA clone VS27Q68 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900062 ID=DC900062|Name=DC900062|organism=Citrus sinensis|type=EST|length=403bp
CTCATTTCTCTCTGGAGCTCTCCATCGGAAGCAGCGGTCGTTTTCGGTAA
GGACCGGCGGGTCGTCACGTGGTGGTTCAGCGACGCTTCTCCTGCTCATA
AATCTTCGTGAAATTTTATAGTCCTTACCATCAGAAATGAGTGGTCGTTT
TTCTTNTNCAATCTATGNTGGCAACCTGCCCTCTGATATAAGAGAATATG
AAGTTGAGGATCTCTTTTACAAGTATGGCCGTATATTGGATATTGAATTA
AAGATCCCCCCTCGCCCACCATGTTATTGTTTTGTTGAGTTTGAGAATGC
TCGTGATGCCGAAGATGCTATTAGAGGTCGTGATGGCTATAACTTTGATG
GTTGTCGTTTAAGGGTTGAGCTCGCCCATGGTGGTAGTGGTAGAGGTCCA
TCA
back to top