DC900061

Overview
NameDC900061
Unique NameDC900061
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length714
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900061 vs. ExPASy Swiss-Prot
Match: CUCM1_CUCME (Cucumisin OS=Cucumis melo PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 5.963e-44
Identity = 92/194 (47.42%), Postives = 121/194 (62.37%), Query Frame = -1
Query:   67 YVRSXHPDWSPSSIKSALMTTALLMNGTVNRGREFDYGSGHIDPVKATNPGLVYEVLEGDYIKMLCGMGYSVNKIRLISGDNSSCPEGTSIATKDLNLPSIAAQVEVHNPFSIKFLRTVTNVGLANTTYKAEVKTTSIDVKINVTPDALSFESVNXXKSFVVTVDGAILQANHTVSASLLWSDGTHNVRSPIVV 648
            YV++ +P WSP++IKSALMTTA  MN   N   EF YGSGH++P+KA  PGLVY+  E DY+K LCG GY+   +R I+GD S+C  G +    DLN PS    V     F+  F RT+T+V    +TY+A +      + I+V P+ LSF  +   KSF +TV G+I      VSASL+WSDG H VRSPI +
Sbjct:  537 YVKTYNPTWSPAAIKSALMTTASPMNARFNPQAEFAYGSGHVNPLKAVRPGLVYDANESDYVKFLCGQGYNTQAVRRITGDYSACTSGNTGRVWDLNYPSFGLSVSPSQTFNQYFNRTLTSVAPQASTYRAMISAPQ-GLTISVNPNVLSFNGLGDRKSFTLTVRGSI--KGFVVSASLVWSDGVHYVRSPITI 727          
BLAST of DC900061 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.628e-33
Identity = 83/204 (40.69%), Postives = 119/204 (58.33%), Query Frame = -1
Query:   67 VRSXHPDWSPSSIKSALMTTA---------LLMNGTVNRGREFDYGSGHIDPVKATNPGLVYEVLEGDYIKMLCGMGYSVNKIRLISGDNSSCPEGTSIATKDLNLPSIAAQVEVHNPFSIKFLRTVTNVGLANTTYKAEVKTTSIDVKINVTPDALSFESVNXXKSFVV--TVDGAILQANHTVSASLLWSDGTHNVRSPIVV 645
            ++S HP+WSP++I+SALMTTA         LL   T      FD+G+GH+ P  ATNPGL+Y++   DY+  LC + Y+  +IR +S  N +C    S +  DLN PS A  V V    + K+ RTVT+VG A  TY  +V + +  VKI+V P  L+F+  N  KS+ V  TVD +    +++   S+ WSDG H V SP+ +
Sbjct:  555 LKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRNYTCDPSKSYSVADLNYPSFA--VNVDGVGAYKYTRTVTSVGGAG-TYSVKVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSF-GSIEWSDGKHVVGSPVAI 754          
BLAST of DC900061 vs. ExPASy Swiss-Prot
Match: XSP1_ARATH (Xylem serine proteinase 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.789e-31
Identity = 76/199 (38.19%), Postives = 114/199 (57.29%), Query Frame = -1
Query:   61 YVRSXHPDWSPSSIKSALMTTALLMNGTVNRGREFDYGSGHIDPVKATNPGLVYEVLEGDYIKMLCGMGYSVNKIRLISGDNS-SCPE-GTSIATKDLNLPSIAAQVEVHNPFSIK-FLRTVTNVGLANTTYKAEVKTTSIDVKINVTPDALSFESVNXXKSFVVTVDGAILQANHTVSASLLWSDGTHNVRSPIVVYT 648
            YV+S HPDW+P++IKSA++T+A  ++  VN+  EF YG G I+P +A +PGLVY++ +  Y++ LCG GY+   +  + G  S SC      +    LN P+I   +      ++  F R VTNVG  ++ Y A V+     V+I V P +LSF   +  +SF V V    +     VS  L+W    H+VRSPIV+Y+
Sbjct:  548 YVKSFHPDWTPAAIKSAIITSAKPISRRVNKDAEFAYGGGQINPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGTRSVSCSSIVPGLGHDSLNYPTIQLTLRSAKTSTLAVFRRRVTNVGPPSSVYTATVRAPK-GVEITVEPQSLSFSKASQKRSFKVVVKAKQMTPGKIVSGLLVWKSPRHSVRSPIVIYS 745          
The following BLAST results are available for this feature:
BLAST of DC900061 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CUCM1_CUCME5.963e-4447.42Cucumisin OS=Cucumis melo PE=1 SV=1[more]
SUBL_ARATH1.628e-3340.69Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
XSP1_ARATH5.789e-3138.19Xylem serine proteinase 1 OS=Arabidopsis thaliana ... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900061 VSS Citrus sinensis cDNA clone VS27Q67 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900061 ID=DC900061|Name=DC900061|organism=Citrus sinensis|type=EST|length=714bp
TTTCAGATCTTATTATATATTGCTATCAAGCATGATCATTCAGAAGTCAA
AACCCTGGTTTGTGTACACAACAATTGGACTTCTTACATTATGAGTTCCA
TCAGACCAAAGAAGTGATGCTGAAACTGTGTGATTTGCCTGCAATATAGC
TCCATCAACGGTCACAACAAAAGATTTNTTNTNATTCACGGATTCAAAGG
ATAGAGCATCAGGGGTCACATTGATCTTGACATCAATAGAAGTAGTTTTC
ACTTCTGCTTTGTAAGTGGTGTTAGCTAGGCCAACATTTGTAACTGTTCT
AAGGAACTTGATACTAAAAGGATTATGTACTTCGACTTGAGCGGCTATTG
ATGGGAGATTAAGATCTTTGGTTGCTATGCTAGTGCCTTCTGGACAACTG
CTATTGTCTCCTGAAATAAGTCTGATCTTATTTACACTGTAACCCATGCC
ACAAAGCATTTTTATGTAGTCACCTTCAAGAACTTCATACACTAAACCAG
GATTTGTTGCTTTGACAGGATCAATATGCCCGGATCCATAATCAAATTCA
CGGCCACGATTTACAGTGCCATTCATTAGCAAAGCAGTGGTCATTAGAGC
GGATTTAATTGATGAAGGAGACCAATCGGGGTGGNAACTTCTAACATAAG
CAGCAGCACCAGCAGCAAAGCACTAGCAATGGNGGTTCACTAAGTATATT
GGATTTAACAAACT
back to top