CN185850

Overview
NameCN185850
Unique NameCN185850
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length773
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185850 vs. ExPASy Swiss-Prot
Match: RLCK7_ARATH (Probable serine/threonine-protein kinase RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.560e-40
Identity = 50/94 (53.19%), Postives = 61/94 (64.89%), Query Frame = 1
Query:  301 LTSWQARPLFQDRTRHSLIADPELQGQYPPRGFYQALAVAAMCVHEQPDMRPVIADVVTALAYLASQKYESDAEKVQSPCLDPGTPTRTKRDKE 582
            L  W ARPLF+DR     + DP LQGQYP RG YQALA++AMCV EQP MRPV++DVV AL +LAS KY+ +     SP    G      RD++
Sbjct:  318 LVGW-ARPLFKDRRNFPKMVDPLLQGQYPVRGLYQALAISAMCVQEQPTMRPVVSDVVLALNFLASSKYDPN-----SPSSSSGKNPSFHRDRD 405          

HSP 2 Score: 91.2781 bits (225), Expect = 4.560e-40
Identity = 39/56 (69.64%), Postives = 49/56 (87.50%), Query Frame = 2
Query:   35 RVIGTYGYCAPEYAKTGQLTLKSDVYSFGVVLLEILSGRKAVDTSKAAAEQSLVAW 202
            RV+GTYGYCAP+YA TGQLT KSD+YSFGVVLLE+++GRKA+D +K   +Q+LV W
Sbjct:  266 RVMGTYGYCAPDYAMTGQLTFKSDIYSFGVVLLELITGRKAIDNTKTRKDQNLVGW 321          
BLAST of CN185850 vs. ExPASy Swiss-Prot
Match: PBS1_ARATH (Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.928e-39
Identity = 41/56 (73.21%), Postives = 49/56 (87.50%), Query Frame = 2
Query:   35 RVIGTYGYCAPEYAKTGQLTLKSDVYSFGVVLLEILSGRKAVDTSKAAAEQSLVAW 202
            RV+GTYGYCAPEYA TGQLT+KSDVYSFGVV LE+++GRKA+D+     EQ+LVAW
Sbjct:  249 RVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAW 304          

HSP 2 Score: 90.5077 bits (223), Expect = 4.928e-39
Identity = 49/104 (47.12%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  301 LTSWQARPLFQDRTRHSLIADPELQGQYPPRGFYQALAVAAMCVHEQPDMRPVIADVVTALAYLASQKYESDAEKVQSPCLDPGTPTRTKRDKERKLNGGRGSE 612
            L +W ARPLF DR +   +ADP L+G++P R  YQALAVA+MC+ EQ   RP+IADVVTAL+YLA+Q Y+   +  +    + G    T+ D      GG GS+
Sbjct:  301 LVAW-ARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLANQAYDPSKDDSRRNRDERGARLITRNDD----GGGSGSK 399          
BLAST of CN185850 vs. ExPASy Swiss-Prot
Match: APK2B_ARATH (Protein kinase 2B, chloroplastic OS=Arabidopsis thaliana GN=APK2B PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.983e-24
Identity = 41/58 (70.69%), Postives = 48/58 (82.76%), Query Frame = 2
Query:   35 RVIGTYGYCAPEYAKTGQLTLKSDVYSFGVVLLEILSGRKAVDTSKAAAEQSLVAWVS 208
            +V+GT+GY APEY  TG+LT KSDVYSFGVVLLE+LSGR+AVD SK   EQSLV W +
Sbjct:  252 QVMGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKSKVGMEQSLVDWAT 309          

HSP 2 Score: 45.4394 bits (106), Expect = 3.983e-24
Identity = 24/68 (35.29%), Postives = 36/68 (52.94%), Query Frame = 1
Query:  301 LTSWQARPLFQDRTRHSLIADPELQGQYPPRGFYQALAVAAMCVHEQPDMRPVIADVVTALAYLASQK 504
            L  W A P   D+ +   I D  L GQYP +G Y A ++A  C++    +RP +++V+  L  L S K
Sbjct:  304 LVDW-ATPYLGDKRKLFRIMDTRLGGQYPQKGAYTAASLALQCLNPDAKLRPKMSEVLAKLDQLESTK 370          
BLAST of CN185850 vs. ExPASy Swiss-Prot
Match: Y2197_ARATH (Probable protein kinase At2g41970 OS=Arabidopsis thaliana GN=At2g41970 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.765e-24
Identity = 40/60 (66.67%), Postives = 48/60 (80.00%), Query Frame = 2
Query:   35 RVIGTYGYCAPEYAKTGQLTLKSDVYSFGVVLLEILSGRKAVDTSKAAAEQSLVAWVSSR 214
            RV+GT+GY APEYA TGQ+T KSDVYSFGVVLLE+L+GRK VD +    +QSLV W + R
Sbjct:  240 RVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPR 299          

HSP 2 Score: 46.595 bits (109), Expect = 6.765e-24
Identity = 24/68 (35.29%), Postives = 37/68 (54.41%), Query Frame = 1
Query:  301 LTSWQARPLFQDRTRHSLIADPELQGQYPPRGFYQALAVAAMCVHEQPDMRPVIADVVTALAYLASQK 504
            L +W    L +D+ +  +  DP+L   +PP+   +  AVAA+CV  + D RP +  VV AL  L + K
Sbjct:  292 LVTWATPRLSEDKVKQCI--DPKLNNDFPPKAVAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSK 357          
BLAST of CN185850 vs. ExPASy Swiss-Prot
Match: Y2706_ARATH (Probable receptor-like protein kinase At2g47060 OS=Arabidopsis thaliana GN=At2g47060 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 7.235e-23
Identity = 39/60 (65.00%), Postives = 46/60 (76.67%), Query Frame = 2
Query:   35 RVIGTYGYCAPEYAKTGQLTLKSDVYSFGVVLLEILSGRKAVDTSKAAAEQSLVAWVSSR 214
            RV+GT+GY APEYA TGQL  KSDVYSFGVVLLE+L+GRK VD      +QSLV W + +
Sbjct:  239 RVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHRLPRGQQSLVTWATPK 298          

HSP 2 Score: 46.2098 bits (108), Expect = 7.235e-23
Identity = 26/76 (34.21%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  301 LTSWQARPLFQDRTRHSLIADPELQGQYPPRGFYQALAVAAMCVHEQPDMRPVIADVVTALAYLASQKYESDAEKV 528
            L +W    L +D+ +  +  D  L G YPP+   +  AVAA+CV  + D RP ++ VV AL  L + +  +  E V
Sbjct:  291 LVTWATPKLSEDKVKQCV--DARLGGDYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNARAVAPGEGV 364          
BLAST of CN185850 vs. ExPASy Swiss-Prot
Match: PTI1_SOLLC (Pto-interacting protein 1 OS=Solanum lycopersicum GN=PTI1 PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 2.699e-22
Identity = 40/60 (66.67%), Postives = 48/60 (80.00%), Query Frame = 2
Query:   35 RVIGTYGYCAPEYAKTGQLTLKSDVYSFGVVLLEILSGRKAVDTSKAAAEQSLVAWVSSR 214
            RV+GT+GY APEYA TGQL+ KSDVYSFGVVLLE+L+GRK VD +    +QSLV W + R
Sbjct:  234 RVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPR 293          

HSP 2 Score: 42.3578 bits (98), Expect = 2.699e-22
Identity = 22/61 (36.07%), Postives = 33/61 (54.10%), Query Frame = 1
Query:  301 LTSWQARPLFQDRTRHSLIADPELQGQYPPRGFYQALAVAAMCVHEQPDMRPVIADVVTAL 483
            L +W    L +D+ +  +  D  L   YPP+   +  AVAA+CV  + D RP ++ VV AL
Sbjct:  286 LVTWATPRLSEDKVKQCV--DARLNTDYPPKAIAKMAAVAALCVQYEADFRPNMSIVVKAL 344          
BLAST of CN185850 vs. ExPASy Swiss-Prot
Match: APK2A_ARATH (Protein kinase 2A, chloroplastic OS=Arabidopsis thaliana GN=APK2A PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 7.704e-22
Identity = 38/58 (65.52%), Postives = 46/58 (79.31%), Query Frame = 2
Query:   35 RVIGTYGYCAPEYAKTGQLTLKSDVYSFGVVLLEILSGRKAVDTSKAAAEQSLVAWVS 208
            +VIGT+GY APEY  TG+LT KSDVYSFGVVLLE++SGR+A+D S    E SLV W +
Sbjct:  255 KVIGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELISGRRAMDNSNGGNEYSLVDWAT 312          

HSP 2 Score: 42.3578 bits (98), Expect = 7.704e-22
Identity = 22/66 (33.33%), Postives = 35/66 (53.03%), Query Frame = 1
Query:  301 LTSWQARPLFQDRTRHSLIADPELQGQYPPRGFYQALAVAAMCVHEQPDMRPVIADVVTALAYLAS 498
            L  W A P   D+ +   I D +L GQYP +G + A  +A  C++    +RP +++V+  L  L S
Sbjct:  307 LVDW-ATPYLGDKRKLFRIMDTKLGGQYPQKGAFTAANLALQCLNPDAKLRPKMSEVLVTLEQLES 371          
BLAST of CN185850 vs. ExPASy Swiss-Prot
Match: SRF8_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsis thaliana GN=SRF8 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.141e-21
Identity = 34/58 (58.62%), Postives = 49/58 (84.48%), Query Frame = 2
Query:   35 RVIGTYGYCAPEYAKTGQLTLKSDVYSFGVVLLEILSGRKAVDTSKAAAEQSLVAWVS 208
            +V+G++GY APE+A +G  T+KSDVY+FGVV+LE+L+GRK +D+S+  AEQSLV W +
Sbjct:  558 QVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWAT 615          

HSP 2 Score: 43.1282 bits (100), Expect = 8.141e-21
Identity = 21/67 (31.34%), Postives = 33/67 (49.25%), Query Frame = 1
Query:  301 LTSWQARPLFQDRTRHSLIADPELQGQYPPRGFYQALAVAAMCVHEQPDMRPVIADVVTALAYLASQ 501
            L  W A P   D    S + DP L G YP +   +   + A+C+  +P+ RP +++VV  L  L  +
Sbjct:  610 LVRW-ATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQLVRLVQR 675          
BLAST of CN185850 vs. ExPASy Swiss-Prot
Match: NAK_ARATH (Probable serine/threonine-protein kinase NAK OS=Arabidopsis thaliana GN=NAK PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.511e-19
Identity = 36/56 (64.29%), Postives = 45/56 (80.36%), Query Frame = 2
Query:   35 RVIGTYGYCAPEYAKTGQLTLKSDVYSFGVVLLEILSGRKAVDTSKAAAEQSLVAW 202
            RV+GT GY APEY  TG L++KSDVYSFGVVLLE+LSGR+A+D ++   E +LV W
Sbjct:  239 RVMGTQGYAAPEYLATGHLSVKSDVYSFGVVLLELLSGRRAIDKNQPVGEHNLVDW 294          

HSP 2 Score: 36.965 bits (84), Expect = 2.511e-19
Identity = 22/75 (29.33%), Postives = 34/75 (45.33%), Query Frame = 1
Query:  301 LTSWQARPLFQDRTRHSLIADPELQGQYPPRGFYQALAVAAMCVHEQPDMRPVIADVVTALAYLASQKYESDAEK 525
            L  W ARP   ++ R   + DP LQGQY      +   +A  C+      RP + ++V  +  L  QK  S  ++
Sbjct:  291 LVDW-ARPYLTNKRRLLRVMDPRLQGQYSLTRALKIAVLALDCISIDAKSRPTMNEIVKTMEELHIQKEASKEQQ 364          
BLAST of CN185850 vs. ExPASy Swiss-Prot
Match: Y5707_ARATH (Probable receptor-like protein kinase At5g47070 OS=Arabidopsis thaliana GN=At5g47070 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.213e-18
Identity = 36/66 (54.55%), Postives = 49/66 (74.24%), Query Frame = 2
Query:   41 IGTYGYCAPEYAKTGQLTLKSDVYSFGVVLLEILSGRKAVDTSKAAAEQSLVAWVSSRNKAPVDSE 238
            +GT+GY APEY +TG L LKSDVYSFGVVL EI++GR+ ++ +K  AE+ L+ WV    + P DS+
Sbjct:  256 VGTHGYAAPEYVQTGHLRLKSDVYSFGVVLYEIITGRRTIERNKPVAERRLLDWV---KEYPADSQ 318          

HSP 2 Score: 36.1946 bits (82), Expect = 1.213e-18
Identity = 21/63 (33.33%), Postives = 30/63 (47.62%), Query Frame = 1
Query:  334 DRTRHSLIADPELQGQYPPRGFYQALAVAAMCVHEQPDMRPVIADVVTALAYLASQKYESDAE 522
            D  R S+I DP L+  YP  G      +A +C+ +    RP +  VV  L  +     ESD+E
Sbjct:  316 DSQRFSMIVDPRLRNNYPAAGARSLAKLADLCLKKNDKERPTMEIVVERLKKIIE---ESDSE 375          
The following BLAST results are available for this feature:
BLAST of CN185850 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
RLCK7_ARATH4.560e-4053.19Probable serine/threonine-protein kinase RLCKVII O... [more]
PBS1_ARATH4.928e-3973.21Serine/threonine-protein kinase PBS1 OS=Arabidopsi... [more]
APK2B_ARATH3.983e-2470.69Protein kinase 2B, chloroplastic OS=Arabidopsis th... [more]
Y2197_ARATH6.765e-2466.67Probable protein kinase At2g41970 OS=Arabidopsis t... [more]
Y2706_ARATH7.235e-2365.00Probable receptor-like protein kinase At2g47060 OS... [more]
PTI1_SOLLC2.699e-2266.67Pto-interacting protein 1 OS=Solanum lycopersicum ... [more]
APK2A_ARATH7.704e-2265.52Protein kinase 2A, chloroplastic OS=Arabidopsis th... [more]
SRF8_ARATH8.141e-2158.62Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsi... [more]
NAK_ARATH2.511e-1964.29Probable serine/threonine-protein kinase NAK OS=Ar... [more]
Y5707_ARATH1.213e-1854.55Probable receptor-like protein kinase At5g47070 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001P11_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001P11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185850 ID=CN185850|Name=CN185850|organism=Citrus sinensis|type=EST|length=773bp
CTTGGTCCTGTTGGTGAAACACCCATGTATCTACAGGGTCATTGGAACTT
ATGGATACTGTGCTCCAGAGTATGCAAAGACAGGCCAACTGACTTTAAAA
TCAGATGTGTATAGCTTTGGGGTTGTTCTTCTGGAAATCCTTTCAGGCAG
GAAAGCAGTTGACACTTCAAAAGCTGCAGCAGAGCAGAGTCTGGTTGCAT
GGGTAAGCAGCAGAAATAAAGCACCTGTTGACTCGGAACTAAGAAGATAT
TTTGAAAAGAGTACTGAGTTTATATAACTTATGCAAATGTTACATTAATC
TTGACTTCATGGCAGGCAAGACCACTGTTCCAAGACCGAACAAGACACTC
ACTCATTGCTGATCCAGAGCTTCAAGGTCAATATCCTCCTAGGGGCTTCT
ATCAAGCTCTTGCTGTTGCAGCAATGTGTGTCCATGAGCAGCCTGATATG
CGACCGGTCATTGCTGATGTGGTCACTGCCTTGGCTTACCTTGCTTCTCA
AAAGTATGAATCTGACGCAGAGAAGGTCCAAAGCCCTTGCCTGGACCCTG
GTACTCCTACTAGAACGAAGAGGGACAAAGAAAGGAAGCTCAACGGTGGT
CGTGGATCTGAAAGAGAGCGAACCAGAAAACTAAAATGAAATTACCCAGT
GTTTGCTACAAGTTGCTTGCACTTCTGGTACGGATCAGGCTTCTCTCATG
CAAGCCAGCCATAGAAACTGCTTAGTGAAGATCGGGAAAATGCTCTGATG
CCAACATTACGATTGTGGTTTTC
back to top