CN185849

Overview
NameCN185849
Unique NameCN185849
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length608
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5958 contig Csv1_Contig5958:98..705. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185849 vs. ExPASy Swiss-Prot
Match: TXD17_DANRE (Thioredoxin domain-containing protein 17 OS=Danio rerio GN=txndc17 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.842e-12
Identity = 36/80 (45.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  103 KNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKTLEASPDDIALLQAYVGDRPTWRNPQHPFRVNSRFKLTGVPTLFRW 342
            K K  F  F  DKD     SWCPDCV+AEPV+   L   P+    +   VGDRP W++  + F+     KLTGVPTL R+
Sbjct:   23 KGKEIFAYFSGDKDEHGK-SWCPDCVKAEPVVRAELPHLPEGTVFIYCQVGDRPYWKDSNNDFK--KTLKLTGVPTLLRY 99          
BLAST of CN185849 vs. ExPASy Swiss-Prot
Match: TXD17_MOUSE (Thioredoxin domain-containing protein 17 OS=Mus musculus GN=Txndc17 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.630e-12
Identity = 39/99 (39.39%), Postives = 56/99 (56.57%), Query Frame = 1
Query:   46 DATVSSFDNVFDKFKSEAPKNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKTLEASPDDIALLQAYVGDRPTWRNPQHPFRVNSRFKLTGVPTLFRW 342
            + +V  F+  FDK   E  + K  F  F   KD +   SWCPDCV AEPVI + L+   +D   +   VGD+P W++P + FR   + K+T VPTL ++
Sbjct:    6 EVSVLGFEE-FDKAVKEH-EGKTIFAYFSGSKD-TEGKSWCPDCVEAEPVIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFR--QKLKITAVPTLLKY 99          
The following BLAST results are available for this feature:
BLAST of CN185849 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
TXD17_DANRE5.842e-1245.00Thioredoxin domain-containing protein 17 OS=Danio ... [more]
TXD17_MOUSE7.630e-1239.39Thioredoxin domain-containing protein 17 OS=Mus mu... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001P10_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001P10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185849 ID=CN185849|Name=CN185849|organism=Citrus sinensis|type=EST|length=608bp
ATGGGAGGCCAGGCCAGCCAAATCCAAATGCCGCTCAACTTGTCGGACGC
AACAGTCTCAAGCTTCGACAATGTCTTTGACAAGTTTAAATCGGAGGCGC
CCAAAAATAAAGCCAATTTCATTCTTTTTCTCGCGGACAAAGATCCCTCT
ACTTCTCTCAGCTGGTGCCCTGATTGCGTGAGAGCTGAACCTGTAATCTA
CAAAACCCTGGAAGCTTCACCAGATGACATCGCACTGCTGCAGGCTTATG
TTGGGGATAGACCAACATGGAGGAATCCTCAGCACCCATTCAGGGTTAAT
TCAAGGTTCAAACTGACGGGAGTTCCGACACTCTTCCGCTGGGAAAATGA
CATAGTCAGCGGCCGTCTTGAAGACCATGAAGCCCATCTCGAGCACAAAA
TCAAAGCCCTTCTTTCTGCCGATTAAGTTCTGATGGTTTCCCATTTGTAG
GATGCACAAGAATCCTATATGGTTGGTTTCCATCTATCTTGGCATTTTTG
CTGGTTTTATATGCATGTTACTAATGCTGGCTAGCGACGTTGCCCTTCAG
TGGGCCATGAAATAAAGTGTCTACTGATGACATTGGATTTTACAAAAAAA
AAAAAAAA
back to top