CN185846

Overview
NameCN185846
Unique NameCN185846
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length727
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185846 vs. ExPASy Swiss-Prot
Match: MMK2_MEDSA (Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 2.127e-113
Identity = 191/211 (90.52%), Postives = 204/211 (96.68%), Query Frame = 3
Query:   93 KYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLFPGKDYVHQLRLITELIGSPDETSLGFLRSDNARRYVRMLPQFPKQNFSARFPNKSPGAVDLLEKMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEHPSFTEE 725
            +YF+YQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCS+YTAAIDIWSVGCILGEI+TRQPLFPG+DYVHQLRL+TELIGSPD+ SLGFLRS+NARRYVR LPQ+PKQNFSARFPN SPGAVDLLEKML+FDP++RI VDEALCHPY+APLHDINEEPVC RPFSFDFE P FTEE
Sbjct:  141 RYFVYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSDYTAAIDIWSVGCILGEIVTRQPLFPGRDYVHQLRLVTELIGSPDDASLGFLRSENARRYVRQLPQYPKQNFSARFPNMSPGAVDLLEKMLIFDPSKRIKVDEALCHPYMAPLHDINEEPVCARPFSFDFEEPMFTEE 351          
BLAST of CN185846 vs. ExPASy Swiss-Prot
Match: MPK4_ARATH (Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana GN=MPK4 PE=1 SV=2)

HSP 1 Score: 404.06 bits (1037), Expect = 4.012e-112
Identity = 191/211 (90.52%), Postives = 203/211 (96.21%), Query Frame = 3
Query:   93 KYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLFPGKDYVHQLRLITELIGSPDETSLGFLRSDNARRYVRMLPQFPKQNFSARFPNKSPGAVDLLEKMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEHPSFTEE 725
            ++FLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLK+GDFGLART SETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGE MTR+PLFPGKDYVHQLRLITELIGSPD++SLGFLRSDNARRYVR LPQ+P+QNF+ARFPN S GAVDLLEKMLVFDP+RRITVDEALCHPYLAPLHDINEEPVC RPF+FDFE P+ TEE
Sbjct:  147 RFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAGAVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEE 357          
BLAST of CN185846 vs. ExPASy Swiss-Prot
Match: MPK11_ARATH (Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 3.755e-110
Identity = 189/211 (89.57%), Postives = 200/211 (94.79%), Query Frame = 3
Query:   93 KYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLFPGKDYVHQLRLITELIGSPDETSLGFLRSDNARRYVRMLPQFPKQNFSARFPNKSPGAVDLLEKMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEHPSFTEE 725
            ++FLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLART SETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTR+PLFPG+DYV QLRLITELIGSPD++SLGFLRSDNARRYVR LPQ+P+QNF+ARFPN S  AVDLL+KMLVFDPNRRITVDEALCHPYLAPLH+ NEEPVC RPF FDFE PS TEE
Sbjct:  144 RFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTREPLFPGRDYVQQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSVNAVDLLQKMLVFDPNRRITVDEALCHPYLAPLHEYNEEPVCVRPFHFDFEQPSLTEE 354          
BLAST of CN185846 vs. ExPASy Swiss-Prot
Match: MPK2_ORYSJ (Mitogen-activated protein kinase 2 OS=Oryza sativa subsp. japonica GN=MPK2 PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 5.075e-107
Identity = 183/211 (86.73%), Postives = 198/211 (93.84%), Query Frame = 3
Query:   93 KYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLFPGKDYVHQLRLITELIGSPDETSLGFLRSDNARRYVRMLPQFPKQNFSARFPNKSPGAVDLLEKMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEHPSFTEE 725
            +YFLYQ+LRGLKYVHSANVLHRDL+PSNLLLNA CDLKIGDFGLARTT+ETDFM EYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEI+TR+PLFPGKDYVHQLRLITELIGSPD++SLGFLRSDNARRYVR LPQ+PKQ F ARFP  S GA+DLLE+MLVFDP++RITVDEALCHPYLA LH+I +EPVCP PFSFDFE PS TEE
Sbjct:  165 QYFLYQVLRGLKYVHSANVLHRDLRPSNLLLNAKCDLKIGDFGLARTTNETDFMMEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIVTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRSLPQYPKQQFRARFPTMSSGAMDLLERMLVFDPSKRITVDEALCHPYLASLHEIYDEPVCPAPFSFDFEQPSLTEE 375          
BLAST of CN185846 vs. ExPASy Swiss-Prot
Match: MPK6_ORYSJ (Mitogen-activated protein kinase 6 OS=Oryza sativa subsp. japonica GN=MPK6 PE=2 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 2.785e-105
Identity = 180/211 (85.31%), Postives = 196/211 (92.89%), Query Frame = 3
Query:   93 KYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLFPGKDYVHQLRLITELIGSPDETSLGFLRSDNARRYVRMLPQFPKQNFSARFPNKSPGAVDLLEKMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEHPSFTEE 725
            +YFLYQLLRGLKYVHSANVLHRDLKPSNL LNANCDLKI DFGLARTT+ETD MTEYVVTRWYRAPELLLNCS+YTAAID+WSVGCILGEI+TRQPLFPG+DY+ QL+LITELIGSPD++SLGFLRSDNARRY++ LPQ+P+Q+F  RF N S GAVDLLEKMLVFDP+RRITVDEAL HPYLA LHDINEEP CP PFSFDFE PSFTEE
Sbjct:  147 QYFLYQLLRGLKYVHSANVLHRDLKPSNLFLNANCDLKIADFGLARTTTETDLMTEYVVTRWYRAPELLLNCSQYTAAIDVWSVGCILGEIVTRQPLFPGRDYIQQLKLITELIGSPDDSSLGFLRSDNARRYMKQLPQYPRQDFRLRFRNMSAGAVDLLEKMLVFDPSRRITVDEALHHPYLASLHDINEEPTCPAPFSFDFEQPSFTEE 357          
BLAST of CN185846 vs. ExPASy Swiss-Prot
Match: MPK12_ARATH (Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 3.523e-100
Identity = 172/211 (81.52%), Postives = 192/211 (91.00%), Query Frame = 3
Query:   93 KYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLFPGKDYVHQLRLITELIGSPDETSLGFLRSDNARRYVRMLPQFPKQNFSARFPNKSPGAVDLLEKMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEHPSFTEE 725
            ++ +YQLLRGLKYVHSAN+LHRDL+PSN+LLN+  +LKIGDFGLARTTS+TDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMT QPLFPGKDYVHQLRLITEL+GSPD +SLGFLRSDNARRYVR LP++PKQ F+ARFP     A+DLLE+MLVFDPNRRI+VDEAL H YL+P HD+ +EPVC  PFSFDFEHPS TEE
Sbjct:  145 RFLVYQLLRGLKYVHSANILHRDLRPSNVLLNSKNELKIGDFGLARTTSDTDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTGQPLFPGKDYVHQLRLITELVGSPDNSSLGFLRSDNARRYVRQLPRYPKQQFAARFPKMPTTAIDLLERMLVFDPNRRISVDEALGHAYLSPHHDVAKEPVCSTPFSFDFEHPSCTEE 355          
BLAST of CN185846 vs. ExPASy Swiss-Prot
Match: MPK5_ARATH (Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2)

HSP 1 Score: 355.525 bits (911), Expect = 1.636e-97
Identity = 168/211 (79.62%), Postives = 191/211 (90.52%), Query Frame = 3
Query:   93 KYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLFPGKDYVHQLRLITELIGSPDETSLGFLRSDNARRYVRMLPQFPKQNFSARFPNKSPGAVDLLEKMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEHPSFTEE 725
            +YFLYQ+LRGLKY+HSANVLHRDLKPSNLLLN+NCDLKI DFGLARTTSET++MTEYVVTRWYRAPELLLN SEYT+AID+WSVGCI  EIMTR+PLFPGKDYVHQL+LITELIGSPD  SL FLRS NAR+YV+ LP+FP+QNFSARFP+ +  A+DLLEKMLVFDP +RITV+EALC+PYL+ LHD+N+EPVC   FSF FE PS TEE
Sbjct:  147 QYFLYQILRGLKYIHSANVLHRDLKPSNLLLNSNCDLKITDFGLARTTSETEYMTEYVVTRWYRAPELLLNSSEYTSAIDVWSVGCIFAEIMTREPLFPGKDYVHQLKLITELIGSPDGASLEFLRSANARKYVKELPKFPRQNFSARFPSMNSTAIDLLEKMLVFDPVKRITVEEALCYPYLSALHDLNDEPVCSNHFSFHFEDPSSTEE 357          
BLAST of CN185846 vs. ExPASy Swiss-Prot
Match: NTF6_TOBAC (Mitogen-activated protein kinase homolog NTF6 OS=Nicotiana tabacum GN=NTF6 PE=2 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 5.099e-91
Identity = 158/211 (74.88%), Postives = 184/211 (87.20%), Query Frame = 3
Query:   93 KYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLFPGKDYVHQLRLITELIGSPDETSLGFLRSDNARRYVRMLPQFPKQNFSARFPNKSPGAVDLLEKMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEHPSFTEE 725
            +YFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKI DFGLARTTSE DFMTEYVVTRWYRAPELLLNC+EYTAAIDIWSVGCIL E++ R+PLFPG+DY  QL LI  L+GSP+++ LGFLRSDNAR+YV+ LP+ P+  FS +FP+ SP A+DL E+MLVFDP +RITV++AL HP+L  LH+INEEPVC  PF+FDFE  S +E+
Sbjct:  142 QYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSEADFMTEYVVTRWYRAPELLLNCTEYTAAIDIWSVGCILMELIKREPLFPGRDYAQQLGLIIALLGSPEDSDLGFLRSDNARKYVKHLPRVPRHPFSQKFPDVSPLALDLAERMLVFDPAKRITVEDALNHPFLISLHEINEEPVCDSPFNFDFEQASLSED 352          
BLAST of CN185846 vs. ExPASy Swiss-Prot
Match: MPK13_ARATH (Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 8.698e-91
Identity = 158/211 (74.88%), Postives = 181/211 (85.78%), Query Frame = 3
Query:   93 KYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLFPGKDYVHQLRLITELIGSPDETSLGFLRSDNARRYVRMLPQFPKQNFSARFPNKSPGAVDLLEKMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEHPSFTEE 725
            +YFLYQ+LRGLKY+HSANVLHRDLKPSNL+LN NCDLKI DFGLART++ET+ MTEYVVTRWYRAPELLLN SEYT AIDIWSVGCI  EI+ R+ LFPGKDYV QL+LITEL+GSPD++ L FLRSDNAR+YV+ LP   KQ+F  +FPN SP A+DL EKMLVFDP++RITVDEAL  PYLA LH+INEEP CP PFSFDFE  +  E+
Sbjct:  137 QYFLYQILRGLKYIHSANVLHRDLKPSNLVLNTNCDLKICDFGLARTSNETEIMTEYVVTRWYRAPELLLNSSEYTGAIDIWSVGCIFMEILRRETLFPGKDYVQQLKLITELLGSPDDSDLDFLRSDNARKYVKQLPHVQKQSFREKFPNISPMALDLAEKMLVFDPSKRITVDEALKQPYLASLHEINEEPTCPTPFSFDFEETALDEQ 347          
BLAST of CN185846 vs. ExPASy Swiss-Prot
Match: MMK1_MEDSA (Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 9.616e-90
Identity = 154/211 (72.99%), Postives = 182/211 (86.26%), Query Frame = 3
Query:   93 KYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLFPGKDYVHQLRLITELIGSPDETSLGFLRSDNARRYVRMLPQFPKQNFSARFPNKSPGAVDLLEKMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEHPSFTEE 725
            +YFLYQ+LRGLKY+HSANVLHRDLKPSNLLLNANCDLKI DFGLAR TSETDFMTEYVVTRWYRAPELLLN S+YTAAID+WSVGCI  E+M R+PLFPG+D+VHQLRL+ ELIG+P E  LGFL ++NA+RY+R LP + +Q+F  +FP+  P A+DL+EKML FDP +RITV++AL HPYL  LHDI++EPVC  PFSFDFE  + TEE
Sbjct:  159 QYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEDDLGFL-NENAKRYIRQLPPYRRQSFQEKFPHVHPEAIDLVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEE 368          
The following BLAST results are available for this feature:
BLAST of CN185846 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
MMK2_MEDSA2.127e-11390.52Mitogen-activated protein kinase homolog MMK2 OS=M... [more]
MPK4_ARATH4.012e-11290.52Mitogen-activated protein kinase 4 OS=Arabidopsis ... [more]
MPK11_ARATH3.755e-11089.57Mitogen-activated protein kinase 11 OS=Arabidopsis... [more]
MPK2_ORYSJ5.075e-10786.73Mitogen-activated protein kinase 2 OS=Oryza sativa... [more]
MPK6_ORYSJ2.785e-10585.31Mitogen-activated protein kinase 6 OS=Oryza sativa... [more]
MPK12_ARATH3.523e-10081.52Mitogen-activated protein kinase 12 OS=Arabidopsis... [more]
MPK5_ARATH1.636e-9779.62Mitogen-activated protein kinase 5 OS=Arabidopsis ... [more]
NTF6_TOBAC5.099e-9174.88Mitogen-activated protein kinase homolog NTF6 OS=N... [more]
MPK13_ARATH8.698e-9174.88Mitogen-activated protein kinase 13 OS=Arabidopsis... [more]
MMK1_MEDSA9.616e-9072.99Mitogen-activated protein kinase homolog MMK1 OS=M... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001P08_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001P08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185846 ID=CN185846|Name=CN185846|organism=Citrus sinensis|type=EST|length=727bp
ATTTATCAGTGGTGTACAGGGTCTCAGTACTATTTGTGCGTTTATGATAG
TGAAAAACAGCAAACTTTTATGAAATAAGTGCAGGATGACATAAGTACTT
CTTGTATCAGTTGTTACGAGGGTTGAAATATGTACACTCAGCAAACGTTT
TGCATCGTGATTTGAAGCCTAGCAATTTGCTCCTTAATGCCAATTGTGAT
CTTAAAATTGGAGACTTTGGGCTTGCAAGGACAACATCAGAAACAGATTT
CATGACTGAGTATGTTGTTACTCGTTGGTACCGGGCACCCGAACTGCTTC
TTAACTGTTCAGAGTATACAGCAGCAATTGATATCTGGTCAGTTGGTTGC
ATACTTGGTGAAATTATGACCAGACAACCCCTGTTCCCTGGAAAAGATTA
TGTCCATCAACTGAGGCTGATCACAGAGCTTATAGGTTCACCTGATGAAA
CCAGCCTTGGGTTTCTACGAAGTGATAATGCCAGAAGATATGTTAGAATG
CTTCCACAATTCCCGAAGCAAAATTTCTCTGCTAGATTTCCAAACAAATC
TCCTGGTGCTGTTGATTTGCTGGAGAAGATGCTTGTCTTTGATCCAAACA
GGCGCATTACAGTTGATGAGGCTCTGTGCCACCCATATTTGGCACCCCTT
CATGATATCAATGAGGAGCCTGTTTGCCCAAGACCATTCAGTTTTGATTT
TGAGCATCCATCATTTACTGAAGAAAA
back to top