DC900059

Overview
NameDC900059
Unique NameDC900059
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length723
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900059 vs. ExPASy Swiss-Prot
Match: CUCM1_CUCME (Cucumisin OS=Cucumis melo PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.145e-57
Identity = 110/211 (52.13%), Postives = 144/211 (68.25%), Query Frame = -3
Query:   86 YNILIGTSMSCPHTAGVAAYVKSFHPDWSPSAIKSAIMTTAWPMKSSNNEEAEFAYGSGHINPIEAVKPGLVYETFKQDYINMLCSIGYDERKVRSISGDNSTCPEGSKQASPKDLNYPSMAAQVSAGKPFTIKFPRTVTNVGLPNSTYKAKILQNEKLSIKVVPEVLSFRSLNEKKSFXXIVTGMLTGQLLSAALVWSDGNHNARSPIIV 718
            +NI+ GTSMSCPH  G+A YVK+++P WSP+AIKSA+MTTA PM +  N +AEFAYGSGH+NP++AV+PGLVY+  + DY+  LC  GY+ + VR I+GD S C  G+      DLNYPS    VS  + F   F RT+T+V    STY+A I   + L+I V P VLSF  L ++KSF   V G + G ++SA+LVWSDG H  RSPI +
Sbjct:  518 FNIISGTSMSCPHITGIATYVKTYNPTWSPAAIKSALMTTASPMNARFNPQAEFAYGSGHVNPLKAVRPGLVYDANESDYVKFLCGQGYNTQAVRRITGDYSACTSGN-TGRVWDLNYPSFGLSVSPSQTFNQYFNRTLTSVAPQASTYRAMISAPQGLTISVNPNVLSFNGLGDRKSFTLTVRGSIKGFVVSASLVWSDGVHYVRSPITI 727          
BLAST of DC900059 vs. ExPASy Swiss-Prot
Match: XSP1_ARATH (Xylem serine proteinase 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.906e-46
Identity = 97/218 (44.50%), Postives = 134/218 (61.47%), Query Frame = -3
Query:   80 KYNILIGTSMSCPHTAGVAAYVKSFHPDWSPSAIKSAIMTTAWPMKSSNNEEAEFAYGSGHINPIEAVKPGLVYETFKQDYINMLCSIGYDERKVRSISGDNS-TCPEGSKQASPKDLNYPSMAAQVSAGKPFTIK-FPRTVTNVGLPNSTYKAKILQNEKLSIKVVPEVLSFRSLNEKKSFXXIVTG--MLTGQLLSAALVWSDGNHNARSPIIVHA 721
            K+ IL GTSM+CPH AGVAAYVKSFHPDW+P+AIKSAI+T+A P+    N++AEFAYG G INP  A  PGLVY+     Y+  LC  GY+   +  + G  S +C           LNYP++   + + K  T+  F R VTNVG P+S Y A +   + + I V P+ LSF   ++K+SF  +V    M  G+++S  LVW    H+ RSPI++++
Sbjct:  528 KFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISRRVNKDAEFAYGGGQINPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGTRSVSCSSIVPGLGHDSLNYPTIQLTLRSAKTSTLAVFRRRVTNVGPPSSVYTATVRAPKGVEITVEPQSLSFSKASQKRSFKVVVKAKQMTPGKIVSGLLVWKSPRHSVRSPIVIYS 745          
BLAST of DC900059 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.308e-40
Identity = 90/225 (40.00%), Postives = 131/225 (58.22%), Query Frame = -3
Query:   86 KYNILIGTSMSCPHTAGVAAYVKSFHPDWSPSAIKSAIMTTAWPMK---------SSNNEEAEFAYGSGHINPIEAVKPGLVYETFKQDYINMLCSIGYDERKVRSISGDNSTCPEGSKQASPKDLNYPSMAAQVSAGKPFTIKFPRTVTNVGLPNSTYKAKIL-QNEKLSIKVVPEVLSFRSLNEKKSFXXIVT---GMLTGQLLSAALVWSDGNHNARSPIIV 721
            ++NI+ GTSMSCPH +G+AA +KS HP+WSP+AI+SA+MTTA+            ++      F +G+GH++P  A  PGL+Y+   +DY+  LC++ Y   ++RS+S  N TC + SK  S  DLNYPS A  V     +  K+ RTVT+VG    TY  K+  +   + I V P VL+F+  NEKKS+    T      +G     ++ WSDG H   SP+ +
Sbjct:  534 EFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRNYTC-DPSKSYSVADLNYPSFAVNVDGVGAY--KYTRTVTSVG-GAGTYSVKVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGSPVAI 754          
The following BLAST results are available for this feature:
BLAST of DC900059 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CUCM1_CUCME2.145e-5752.13Cucumisin OS=Cucumis melo PE=1 SV=1[more]
XSP1_ARATH2.906e-4644.50Xylem serine proteinase 1 OS=Arabidopsis thaliana ... [more]
SUBL_ARATH5.308e-4040.00Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900059 VSS Citrus sinensis cDNA clone VS27Q66 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900059 ID=DC900059|Name=DC900059|organism=Citrus sinensis|type=EST|length=723bp
ACAGCAAGCAATTGAAGTTCAATTTATTCCATTTCCAACTACACATATCG
CGTTATATATTTTAGCCTTGTGCCCCCTGTGCATGTACAATAATTGGGCT
TCTGGCGTTATGATTGCCATCAGACCACACCAAGGCAGCAGAGAGAAGTT
GTCCCGTTAGCATTCCTGTAACAATNNCNTTAAAAGACTTCTTCTCATTC
AAGGACCTAAAAGAGAGAACTTCAGGTACAACTTTGATACTCAATTTTTC
ATTTTGCAAGATTTTTGCCTTGTAAGTGGAGTTTGGAAGGCCAACGTTTG
TAACTGTCCTTGGAAATTTGATTGTGAAAGGCTTCCCAGCTGAAACTTGA
GCTGCCATTGAAGGGTAGTTGAGATCTTTTGGGGAAGCTTGCTTTGAGCC
TTCAGGACAAGTGCTGTTATCTCCTGAGATGCTTCTAACTTTTCTCTCAT
CATAACCAATGCTGCAGAGCATATTTATGTAGTCTTGTTTGAAAGTTTCA
TACACAAGTCCTGGTTTTACAGCTTCAATTGGATTGATATGCCCCGAACC
ATATGCAAATTCAGCTTCTTCATTGTTGGAAGACTTCATGGGCCATGCAG
TAGTCATAATAGCTGATTTGATGGCAGAAGGAGACCAATCAGGGTGAAAT
GATTTAACATATGCGGCTACACCAGCAGTATGCGGGCAGGACATGGAGGT
TCCTATTAGAATATTATATTTAG
back to top