DC900058

Overview
NameDC900058
Unique NameDC900058
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length754
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900058 vs. ExPASy Swiss-Prot
Match: CUCM1_CUCME (Cucumisin OS=Cucumis melo PE=1 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.579e-56
Identity = 110/204 (53.92%), Postives = 144/204 (70.59%), Query Frame = 2
Query:    5 RWKGDCQGGRNFTCNKKIIGARYYSIH-----DEYDTARDEEGHGSHTASTAAGNIXEGVSFFGLGQGTARGGVPSARISAYKVCSEFGCSDANILAAFDDAIADGVDIITISMGTRHARDFSQDSIAIGAFHAMAKGILVVNSAGNSGPEPRSVSSIAPWMMSVAASGTDRLFVDKVVLGNGTTVVGYSLNAFTLEGKQLPLI 601
            +WKG C+   NF CN+KIIGAR Y I       + +  RD  GHG+HTASTAAG +    + +GLG GTARGGVP ARI+AYKVC   GCSD +ILAA+DDAIADGVDII++S+G  + R +  D+IAIG+FHA+ +GIL  NSAGN GP   + +S++PW++SVAAS  DR FV +V +GNG +  G S+N F  + +  PL+
Sbjct:  161 KWKGTCETSNNFRCNRKIIGARSYHIGRPISPGDVNGPRDTNGHGTHTASTAAGGLVSQANLYGLGLGTARGGVPLARIAAYKVCWNDGCSDTDILAAYDDAIADGVDIISLSVGGANPRHYFVDAIAIGSFHAVERGILTSNSAGNGGPNFFTTASLSPWLLSVAASTMDRKFVTQVQIGNGQSFQGVSINTF--DNQYYPLV 362          
BLAST of DC900058 vs. ExPASy Swiss-Prot
Match: XSP1_ARATH (Xylem serine proteinase 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.607e-50
Identity = 108/216 (50.00%), Postives = 145/216 (67.13%), Query Frame = 2
Query:    5 RWKGDCQGGRNFT-CNKKIIGARYYSIHD------EYDTARDEEGHGSHTASTAAGNIXEGVSFFGLGQGTARGGVPSARISAYKVC-SEFGCSDANILAAFDDAIADGVDIITISMGTRHARDFSQDSIAIGAFHAMAKGILVVNSAGNSGPEPRSVSSIAPWMMSVAASGTDRLFVDKVVLGNGTTVVGYSLNAFTLEGKQLPLI--YDAASPT 622
            +WKG C   +NFT CN KIIGA+Y+  HD      E  +  D +GHG+HT+ST AG +    S +G+  GTARG VPSAR++ YKVC +  GC+D +ILA F+ AI DGV+II+IS+G   A D+S DSI++G+FHAM KGIL V SAGN GP   +V++  PW+++VAASG DR F  K+ LGNG +  G  ++ F+ + K  PL+   DAA  T
Sbjct:  166 KWKGSCGPYKNFTGCNNKIIGAKYFK-HDGNVPAGEVRSPIDIDGHGTHTSSTVAGVLVANASLYGIANGTARGAVPSARLAMYKVCWARSGCADMDILAGFEAAIHDGVEIISISIGGPIA-DYSSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGIDRTFKSKIDLGNGKSFSGMGISMFSPKAKSYPLVSGVDAAKNT 379          
BLAST of DC900058 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.086e-46
Identity = 105/233 (45.06%), Postives = 145/233 (62.23%), Query Frame = 2
Query:    8 WKGDCQGGRNFT---CNKKIIGARYYSI-----------HDEYDTARDEEGHGSHTASTAAGNIXEGVSFFGLGQGTARGGVPSARISAYKVCSEFGCSDANILAAFDDAIADGVDIITISMGTRHARDFSQDSIAIGAFHAMAKGILVVNSAGNSGPEPRSVSSIAPWMMSVAASGTDRLFVDKVVLGNGTTVVGYSL-NAFTLEGKQLPLIY--DAASPT----CLDGSFI 643
            WKG C+ G NFT   CN+K+IGAR+++              E  + RD++GHG+HT+STAAG++ EG S  G   GTARG  P AR++ YKVC   GC  ++ILAA D AIAD V+++++S+G   + D+ +D +AIGAF AM +GILV  SAGN+GP   S+S++APW+ +V A   DR F    +LGNG    G SL     L  K LP IY  +A++ T    C+ G+ I
Sbjct:  161 WKGGCEAGTNFTASLCNRKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGTARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLGGGMS-DYYRDGVAIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLI 392          
The following BLAST results are available for this feature:
BLAST of DC900058 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CUCM1_CUCME2.579e-5653.92Cucumisin OS=Cucumis melo PE=1 SV=1[more]
XSP1_ARATH3.607e-5050.00Xylem serine proteinase 1 OS=Arabidopsis thaliana ... [more]
SUBL_ARATH1.086e-4645.06Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900058 VSS Citrus sinensis cDNA clone VS27Q66 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900058 ID=DC900058|Name=DC900058|organism=Citrus sinensis|type=EST|length=754bp
CAAGAGGTGGAAAGGTGATTGCCAAGGTGGCAGAAATTTCACTTGTAACA
AAAAAATTATTGGAGCTCGATATTACTCTATACACGATGAATATGATACA
GCTAGGGATGAAGAGGGACATGGATCCCATACTGCCTCTACGGCGGCTGG
AAACATANTAGAGGGTGTTAGTTTTTTCGGACTAGGTCAAGGCACTGCAA
GGGGAGGGGTTCCTTCTGCAAGAATTTCTGCATATAAAGTCTGTTCTGAA
TTTGGGTGTTCAGATGCAAATATATTGGCAGCTTTTGATGATGCTATTGC
CGATGGAGTTGACATTATTACAATCTCAATGGGCACACGACATGCACGTG
ATTTTTCGCAAGATTCCATTGCAATTGGGGCTTTTCACGCGATGGCAAAA
GGAATACTGGTTGTAAATTCTGCTGGCAATAGCGGTCCTGAACCAAGATC
AGTGTCGAGCATCGCTCCATGGATGATGTCTGTAGCAGCCAGTGGCACAG
ATCGCTTGTTTGTGGACAAGGTTGTTCTGGGAAATGGAACAACCGTAGTG
GGTTATTCCCTTAATGCTTTCACTCTGGAAGGAAAACAGTTGCCGCTCAT
ATATGACGCTGCCAGCCCGACGTGTTTAGATGGGTCTTTTATACTAGCTT
GGTGAANGGGAAGATTGTTCTATGTGATCAATTNCAGGATATTCTGAGGC
TAAAAAGCTGGGGCTGCAGGATCATCTGAAAAAGGTGGTGCCAAGTTCCT
TCGT
back to top