CN185843

Overview
NameCN185843
Unique NameCN185843
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length775
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3681 contig Csv1_Contig3681:23..797. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185843 vs. ExPASy Swiss-Prot
Match: RBD2A_ARATH (Ras-related protein RABD2A OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3)

HSP 1 Score: 296.59 bits (758), Expect = 1.012e-79
Identity = 144/161 (89.44%), Postives = 153/161 (95.03%), Query Frame = -1
Query:  293 VDFKIRTVDQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKSATNVEQAFMAMAASIKNRMASQPASNNARPPTVQIRGQPVNQKSGCCST 775
            VDFKIRTV+QDGKTIKLQIWDTAGQERFRTITSSYYRGAHGII+VYDVTD+ESFNNVKQWL+EIDRYAS+NVNKLLVGNK DLT N+ + YETAKAFADEIGIPFMETSAK ATNVEQAFMAM+ASIK RMASQPA NNARPPTVQIRGQPV QK+GCCST
Sbjct:   43 VDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKSDLTENRAIPYETAKAFADEIGIPFMETSAKDATNVEQAFMAMSASIKERMASQPAGNNARPPTVQIRGQPVAQKNGCCST 203          
BLAST of CN185843 vs. ExPASy Swiss-Prot
Match: YPTM2_MAIZE (GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.943e-79
Identity = 145/161 (90.06%), Postives = 156/161 (96.89%), Query Frame = -1
Query:  293 VDFKIRTVDQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKSATNVEQAFMAMAASIKNRMASQPASNNARPPTVQIRGQPVNQKSGCCST 775
            VDFKIRTV+QDGKTIKLQIWDTAGQERFRTITSSYYRGAHGII+VYDVTDQESFNNVKQWLNEIDRYAS+NVNKLLVGNK DLTANKVV+ ETAKAFADE+GIPFMETSAK+ATNV+QAFMAMAASIK+RMASQPA+ NARP TVQIRGQPVNQK+ CCS+
Sbjct:   43 VDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKSDLTANKVVATETAKAFADEMGIPFMETSAKNATNVQQAFMAMAASIKDRMASQPAAANARPATVQIRGQPVNQKTSCCSS 203          
BLAST of CN185843 vs. ExPASy Swiss-Prot
Match: RIC1_ORYSJ (Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2)

HSP 1 Score: 283.493 bits (724), Expect = 8.862e-76
Identity = 138/160 (86.25%), Postives = 147/160 (91.88%), Query Frame = -1
Query:  296 VDFKIRTVDQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKSATNVEQAFMAMAASIKNRMASQPASNNARPPTVQIRGQPVNQKSGCCS 775
            VDFKIRTV+QDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDL  N+VVSYE  KA ADEIGIPF+ETSAK ATNVE+AFM MA  IKNRMASQPA+N ++P TVQ+RGQPV Q+S CCS
Sbjct:   43 VDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLAENRVVSYEAGKALADEIGIPFLETSAKDATNVEKAFMTMAGEIKNRMASQPATNASKPATVQMRGQPVAQQSSCCS 202          
BLAST of CN185843 vs. ExPASy Swiss-Prot
Match: YPTC1_CHLRE (GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.370e-68
Identity = 131/160 (81.88%), Postives = 139/160 (86.88%), Query Frame = -1
Query:  299 VDFKIRTVDQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKSATNVEQAFMAMAASIKNRMASQPASNNARPPTVQIR-GQPVNQKSGCC 775
            VDFKIRTV+ DGK IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNK DLT+ KVV Y  AKAFADEIGIPF+ETSAK+ATNVEQAFM MAA IKNRMASQP    A  P V+ + G+P+N KS  C
Sbjct:   43 VDFKIRTVELDGKVIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKSDLTSKKVVEYSVAKAFADEIGIPFLETSAKNATNVEQAFMTMAAEIKNRMASQPIPTKAGGPVVRPQEGKPINSKSSSC 202          
BLAST of CN185843 vs. ExPASy Swiss-Prot
Match: YPTV1_VOLCA (GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 3.375e-67
Identity = 129/160 (80.62%), Postives = 136/160 (85.00%), Query Frame = -1
Query:  299 VDFKIRTVDQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKSATNVEQAFMAMAASIKNRMASQPASNNARPPTVQ-IRGQPVNQKSGCC 775
            VDFKIRTV+ DGK IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWL EIDRYASENVNKLLVGNK DLT  KVV Y+ AKAFADEIGIPF+ETSAK+ATNVEQAFM MAA IKNRMASQP       P V+   G+P+N KS  C
Sbjct:   43 VDFKIRTVELDGKVIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLAEIDRYASENVNKLLVGNKSDLTGKKVVDYQAAKAFADEIGIPFLETSAKNATNVEQAFMTMAAEIKNRMASQPVPPKPGGPVVRPTEGKPINNKSSSC 202          
BLAST of CN185843 vs. ExPASy Swiss-Prot
Match: RAB1A_RAT (Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 4.126e-65
Identity = 122/159 (76.73%), Postives = 131/159 (82.39%), Query Frame = -1
Query:  299 VDFKIRTVDQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKSATNVEQAFMAMAASIKNRMASQPASNNARPPTVQIRGQPVNQKSGCC 775
            VDFKIRT++ DGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWL EIDRYASENVNKLLVGNKCDLT  KVV Y TAK FAD +GIPF+ETSAK+ATNVEQ+FM MAA IK RM     +  A    V+I+  PV Q  G C
Sbjct:   46 VDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
BLAST of CN185843 vs. ExPASy Swiss-Prot
Match: RAB1A_MOUSE (Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 4.126e-65
Identity = 122/159 (76.73%), Postives = 131/159 (82.39%), Query Frame = -1
Query:  299 VDFKIRTVDQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKSATNVEQAFMAMAASIKNRMASQPASNNARPPTVQIRGQPVNQKSGCC 775
            VDFKIRT++ DGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWL EIDRYASENVNKLLVGNKCDLT  KVV Y TAK FAD +GIPF+ETSAK+ATNVEQ+FM MAA IK RM     +  A    V+I+  PV Q  G C
Sbjct:   46 VDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
BLAST of CN185843 vs. ExPASy Swiss-Prot
Match: RAB1A_HUMAN (Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 4.126e-65
Identity = 122/159 (76.73%), Postives = 131/159 (82.39%), Query Frame = -1
Query:  299 VDFKIRTVDQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKSATNVEQAFMAMAASIKNRMASQPASNNARPPTVQIRGQPVNQKSGCC 775
            VDFKIRT++ DGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWL EIDRYASENVNKLLVGNKCDLT  KVV Y TAK FAD +GIPF+ETSAK+ATNVEQ+FM MAA IK RM     +  A    V+I+  PV Q  G C
Sbjct:   46 VDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
BLAST of CN185843 vs. ExPASy Swiss-Prot
Match: RAB1A_CANFA (Ras-related protein Rab-1A OS=Canis familiaris GN=RAB1A PE=1 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 4.126e-65
Identity = 122/159 (76.73%), Postives = 131/159 (82.39%), Query Frame = -1
Query:  299 VDFKIRTVDQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKSATNVEQAFMAMAASIKNRMASQPASNNARPPTVQIRGQPVNQKSGCC 775
            VDFKIRT++ DGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWL EIDRYASENVNKLLVGNKCDLT  KVV Y TAK FAD +GIPF+ETSAK+ATNVEQ+FM MAA IK RM     +  A    V+I+  PV Q  G C
Sbjct:   46 VDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
BLAST of CN185843 vs. ExPASy Swiss-Prot
Match: RAB1_DISOM (Ras-related protein ORAB-1 OS=Discopyge ommata PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 9.192e-65
Identity = 122/159 (76.73%), Postives = 129/159 (81.13%), Query Frame = -1
Query:  299 VDFKIRTVDQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKSATNVEQAFMAMAASIKNRMASQPASNNARPPTVQIRGQPVNQKSGCC 775
            VDFKIRT++ DGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWL EIDRYASENVNKLLVGNKCDLT  KVV Y TAK FAD +GIPF+ETSAK+ATNVEQAFM MAA IK RM     S  +    V I+  PV    G C
Sbjct:   43 VDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATSGGSEKSNVNIQSTPVKSSGGGC 201          
The following BLAST results are available for this feature:
BLAST of CN185843 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RBD2A_ARATH1.012e-7989.44Ras-related protein RABD2A OS=Arabidopsis thaliana... [more]
YPTM2_MAIZE2.943e-7990.06GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=... [more]
RIC1_ORYSJ8.862e-7686.25Ras-related protein RIC1 OS=Oryza sativa subsp. ja... [more]
YPTC1_CHLRE1.370e-6881.88GTP-binding protein YPTC1 OS=Chlamydomonas reinhar... [more]
YPTV1_VOLCA3.375e-6780.63GTP-binding protein yptV1 OS=Volvox carteri GN=YPT... [more]
RAB1A_RAT4.126e-6576.73Ras-related protein Rab-1A OS=Rattus norvegicus GN... [more]
RAB1A_MOUSE4.126e-6576.73Ras-related protein Rab-1A OS=Mus musculus GN=Rab1... [more]
RAB1A_HUMAN4.126e-6576.73Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1... [more]
RAB1A_CANFA4.126e-6576.73Ras-related protein Rab-1A OS=Canis familiaris GN=... [more]
RAB1_DISOM9.192e-6576.73Ras-related protein ORAB-1 OS=Discopyge ommata PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001P07_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001P07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185843 ID=CN185843|Name=CN185843|organism=Citrus sinensis|type=EST|length=775bp
GAGAGAGAACATTTATATATTAGCTACATCGATGACGAACAATATACAGT
ATAGAGGACAGCAAGATAGATACCGCTATTCACCAATATTCCTAATTTGT
ACAAATGTTTTCTTGAAACCCAATACATTTGAAAAGAATGGAAACTTTAG
TAAAGTAACGAACAACTGACAAGAAAAGCAAATCATGACAATAAACCTTC
ATATCAAAGCATATAAGAAGAGAGAACTAGTGTTACATTCCACAAAGAAC
ATTGATAAACATCAGAAATTCACCAACACTAATTCCCTTCTAAGTGGAGC
AGCAACCAGATTTCTGGTTGACAGGCTGTCCTCGGATCTGCACTGTTGGC
GGCCTAGCATTGTTCGAGGCAGGTTGGCTTGCCATCCTATTCTTGATTGA
AGCAGCCATGGCCATGAAAGCCTGTTCGACGTTGGTGGCACTTTTAGCAC
TTGTTTCCATGAAAGGAATCCCAATTTCATCCGCAAATGCCTTGGCTGTC
TCATAGGACACAACTTTGTTCGCTGTGAGATCACACTTGTTACCAACTAA
AAGCTTGTTCACATTTTCACTTGCATATCGGTCAATTTCATTCAGCCATT
GCTTTACATTGTTGAAGCTCTCTTGATCTGTGACATCATAAACAACAATG
ATGCCATGAGCCCCACGATAGTAGCTGCTGGTTATTGTCCTAAAACGCTC
TTGGCCAGCAGTGTCCCAAATTTGGAGCTTAATGGTTTTGCCATCTTGGT
CCACAGTGCGGATTTTAAAGTCAAC
back to top