DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ORYA_ORYSJ (Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2)

HSP 1 Score: 306.605 bits (784), Expect = 1.308e-82
Identity = 134/196 (68.37%), Postives = 154/196 (78.57%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKP 591
            +LQKAVANQPVSVAIE GG AFQLY SGIFTG+CGT+LDHGV AVGYGTE G DYWIV+NSWG SWGE GY+RMERN+  + +GKCGIA+E SY                       VCDNYY+CP+S TCCC++EYG  C+AWGCCPLE ATCCDDHYSCCPH+YPICNV+ GTCLM+KD+PL V+AL+RT AKP
Sbjct:  250 SLQKAVANQPVSVAIEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKAS-SGKCGIAVEPSYPLKKGENPPNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKALKRTLAKP 444          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 4.653e-80
Identity = 127/204 (62.25%), Postives = 156/204 (76.47%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHGNQ 612
            ++L+KAVA+QP+S+AIE GG AFQLY+SGIF G CGT LDHGV AVGYGTE G DYWIV+NSWG SWGE GY+RM RN+A + +GKCGIA+E SY                        CD+YY+CPESNTCCC+FEYG  CFAWGCCPLEAATCCDD+YSCCPH+YP+C++  GTCL+SK++P  V+AL+R PA P+W+ G +
Sbjct:  257 ESLKKAVAHQPISIAIEAGGRAFQLYDSGIFDGSCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASS-SGKCGIAIEPSYPIKNGENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGRK 459          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSPL_SOLLC (Low-temperature-induced cysteine proteinase (Fragment) OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 8.795e-71
Identity = 118/205 (57.56%), Postives = 145/205 (70.73%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHGNQG 615
            KALQKAVA+QPVS+A+E GG  FQ Y+SGIFTG+CGT++DHGV   GYGTE G DYWIV+NSWG++  E GY+R++RNV+ + +G CG+A+E SY                        CD Y  C    TCCC+ ++  SCF+WGCCPLE ATCC+DHYSCCPHDYPICNVR GTC MSK NPLGV+A++R  A+P  A GN G
Sbjct:  138 KALQKAVAHQPVSIALEAGGRDFQHYKSGIFTGKCGTAVDHGVVIAGYGTENGMDYWIVRNSWGANCRENGYLRVQRNVSSS-SGLCGLAIEPSYPVKTGPNPPKPAPSPPSPVKPPTECDEYSQCAVGTTCCCILQFRRSCFSWGCCPLEGATCCEDHYSCCPHDYPICNVRQGTCSMSKGNPLGVKAMKRILAQPIGAFGNGG 341          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ORYB_ORYSJ (Oryzain beta chain OS=Oryza sativa subsp. japonica GN=Os04g0670200 PE=1 SV=2)

HSP 1 Score: 265.388 bits (677), Expect = 3.342e-70
Identity = 123/202 (60.89%), Postives = 141/202 (69.80%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXA------VCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAK 588
            K+LQKAVA+QPVSVAIE GG  FQLY SG+F+GRCGTSLDHGV AVGYGT+ G DYWIV+NSWG  WGE GY+RMERN+  T TGKCGIAM ASY                             VCD+ +SCP  +TCCC F + N C  WGCCP+E ATCC DH SCCP DYP+CN RAGTC  SK++PL V+AL+RT AK
Sbjct:  262 KSLQKAVAHQPVSVAIEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINVT-TGKCGIAMMASYPTKSGANPPKPSPTPPTPPTPPPPSAPDHVCDDNFSCPAGSTCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKALKRTLAK 462          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP1_ORYSJ (Cysteine protease 1 OS=Oryza sativa subsp. japonica GN=CP1 PE=2 SV=2)

HSP 1 Score: 234.958 bits (598), Expect = 4.837e-61
Identity = 111/202 (54.95%), Postives = 129/202 (63.86%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEX--GADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRA----LRRTPAKP 591
            +LQKAVA+QPVSVAI+ GG  FQLY+SG+FTGRCGT+LDHGV AVGYGT+   GA YW V+NSWG  WGE GYIRMERNV    TGKCGIAM ASY                        CD Y  CP   TCCC +   N C  WGCCP+E ATCC DH +CCP +YP+CN +A TC  SK++P  +R      R  P +P
Sbjct:  278 SLQKAVAHQPVSVAIDAGGREFQLYDSGVFTGRCGTNLDHGVVAVGYGTDAATGAAYWTVRNSWGPDWGENGYIRMERNVTAR-TGKCGIAMMASYPIKKGPNPKPSPPSPAPSPPQQ--CDRYSKCPAGTTCCCNYGIRNHCIVWGCCPVEGATCCKDHSTCCPKEYPVCNAKARTCSKSKNSPYNIRTPAAMARSVPEQP 476          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: GCP1_ARATH (Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2)

HSP 1 Score: 149.828 bits (377), Expect = 2.046e-35
Identity = 68/94 (72.34%), Postives = 79/94 (84.04%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL+KA++ QPVSVAIE GG  FQ Y+SGIFTG CGT+LDH V AVGYG+E G DYWIV+NSWG  WGE GYIRMERN+A + +GKCGIA+EASY
Sbjct:  266 ALKKAISYQPVSVAIEAGGRIFQHYQSGIFTGSCGTNLDHAVVAVGYGSENGVDYWIVRNSWGPRWGEEGYIRMERNLAASKSGKCGIAVEASY 359          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP4_BRANA (Cysteine proteinase COT44 (Fragment) OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.776e-35
Identity = 68/94 (72.34%), Postives = 82/94 (87.23%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL++AV+ QPVSVAI+ GG AFQ Y+SGIFTG+CGT++DH V AVGYG+E G DYWIV+NSWG+ WGE GYIRMERNVA + +GKCGIA+EASY
Sbjct:  221 ALKRAVSYQPVSVAIDAGGRAFQHYQSGIFTGKCGTNMDHAVVAVGYGSENGVDYWIVRNSWGTRWGEDGYIRMERNVA-SKSGKCGIAIEASY 313          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP_HEMSP (Thiol protease SEN102 OS=Hemerocallis sp. GN=SEN102 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.793e-31
Identity = 64/95 (67.37%), Postives = 71/95 (74.74%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYG-TEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL +AVANQP+SV+IE  G  FQ Y  G+FTGRCGT LDHGV  VGYG T  G  YWIVKNSWG  WGE GYIRM+R ++    GKCGIAMEASY
Sbjct:  250 ALMQAVANQPISVSIEASGYGFQFYSEGVFTGRCGTELDHGVAIVGYGATRDGTKYWIVKNSWGEEWGESGYIRMQRGISDK-RGKCGIAMEASY 343          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CPR1_ARATH (Probable cysteine proteinase At3g19400 OS=Arabidopsis thaliana GN=At3g19400 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.982e-30
Identity = 59/95 (62.11%), Postives = 74/95 (77.89%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            K+L+KAVA+QPVSVAIE    AFQLY+SG+ TG CG SLDHGV  VGYG+  G DYWI++NSWG +WG+ GY++++RN+     GKCGIAM  SY
Sbjct:  253 KSLKKAVAHQPVSVAIEASSQAFQLYKSGVMTGTCGISLDHGVVVVGYGSTSGEDYWIIRNSWGLNWGDSGYVKLQRNIDDPF-GKCGIAMMPSY 346          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSEP_RICCO (Vignain OS=Ricinus communis GN=CYSEP PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 4.416e-30
Identity = 65/95 (68.42%), Postives = 69/95 (72.63%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTE-XGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL KAVANQPVSVAI+ GG  FQ Y  G+FTG CGT LDHGV  VGYGT   G  YW VKNSWG  WGE GYIRMER ++    G CGIAMEASY
Sbjct:  247 ALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGSCGTELDHGVAIVGYGTTIDGTKYWTVKNSWGPEWGEKGYIRMERGISDK-EGLCGIAMEASY 340          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
ORYA_ORYSJ1.308e-8268.37Oryzain alpha chain OS=Oryza sativa subsp. japonic... [more]
RD21A_ARATH4.653e-8062.25Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]
CYSPL_SOLLC8.795e-7157.56Low-temperature-induced cysteine proteinase (Fragm... [more]
ORYB_ORYSJ3.342e-7060.89Oryzain beta chain OS=Oryza sativa subsp. japonica... [more]
CYSP1_ORYSJ4.837e-6154.95Cysteine protease 1 OS=Oryza sativa subsp. japonic... [more]
GCP1_ARATH2.046e-3572.34Germination-specific cysteine protease 1 OS=Arabid... [more]
CYSP4_BRANA7.776e-3572.34Cysteine proteinase COT44 (Fragment) OS=Brassica n... [more]
CYSP_HEMSP1.793e-3167.37Thiol protease SEN102 OS=Hemerocallis sp. GN=SEN10... [more]
CPR1_ARATH1.982e-3062.11Probable cysteine proteinase At3g19400 OS=Arabidop... [more]
CYSEP_RICCO4.416e-3068.42Vignain OS=Ricinus communis GN=CYSEP PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top