DC900052

Overview
NameDC900052
Unique NameDC900052
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length877
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900052 vs. ExPASy Swiss-Prot
Match: FAB1_YEAST (1-phosphatidylinositol-3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae GN=FAB1 PE=1 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.199e-58
Identity = 107/209 (51.20%), Postives = 151/209 (72.25%), Query Frame = 3
Query:    3 ELESFIKFGPAYFKYLSESISTGSPTCLAKILGIYQVASKH-FKGGKESKMDLLVMENLLFRRNITRLYDLKGSSRSRYNADTSGSNKVLLDQNLIEAMPTSPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWDKHLETWVKTSGILGGPK-NTSPTVISPQQYKKRFRKAMTTYFLMLPEQW 623
            ELE+FIKF P+YF+Y+++++    PT LAK+ G YQ+  K      K  KMD+++MENL + +  TR++DLKGS R+R+   T  +N+VLLD+N++E +  SPI V    K+LL  +VWNDT FLA ++VMDYSL++GID E + L +GIIDF+R +TWDK LE+WVK  G++GG      PTV++P+QYKKRFR+AM  Y LM+P+ W
Sbjct: 2065 ELEAFIKFAPSYFEYMAQAMFHDLPTTLAKVFGFYQIQVKSSISSSKSYKMDVIIMENLFYEKKTTRIFDLKGSMRNRHVEQTGKANEVLLDENMVEYIYESPIHVREYDKKLLRASVWNDTLFLAKMNVMDYSLVIGIDNEGYTLTVGIIDFIRTFTWDKKLESWVKEKGLVGGASVIKQPTVVTPRQYKKRFREAMERYILMVPDPW 2273          
BLAST of DC900052 vs. ExPASy Swiss-Prot
Match: FYV1_DICDI (1-phosphatidylinositol-3-phosphate 5-kinase OS=Dictyostelium discoideum GN=pip5k3 PE=3 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 4.881e-52
Identity = 110/208 (52.88%), Postives = 143/208 (68.75%), Query Frame = 3
Query:    3 ELESFIKFGPAYFKYLSESISTGSPTCLAKILGIYQVASKHFKGGKESKMDLLVMENLLFRRNITRLYDLKGSSRSRYNADTSGSNKVLLDQNLIEAMPTSPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWDKHLETWVKTSGILGGPKNTSPTVISPQQYKKRFRKAMTTYFLMLPEQWT 626
            ELESF+ F P YF+Y+ +S     PT L KILG++ V  K    GK  K DL+VMENL   + I++ YDLKGS R R        ++VLLD+NL++A   SPI +G   K  +  AVWNDTAFL+S++VMDYSLL GID + ++LV+GIID+MR++TWDK LE  VK SGI+GG     PTVISP+QYK RFR AM  YF + P+++T
Sbjct: 2402 ELESFLDFAPLYFEYICKSFLNQIPTALCKILGVFTVRWKD-SNGKALKKDLIVMENLFHSKCISKTYDLKGSLRGRL---VKNESEVLLDENLLQASFASPICLGEYDKTRVALAVWNDTAFLSSLNVMDYSLLSGIDNQSNQLVVGIIDYMRKFTWDKALEMKVKQSGIMGGGGKV-PTVISPKQYKLRFRDAMWLYFTLSPDKFT 2604          
BLAST of DC900052 vs. ExPASy Swiss-Prot
Match: FAB1_SCHPO (1-phosphatidylinositol-3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe GN=fab1 PE=2 SV=2)

HSP 1 Score: 200.29 bits (508), Expect = 1.202e-50
Identity = 97/201 (48.26%), Postives = 136/201 (67.66%), Query Frame = 3
Query:    3 ELESFIKFGPAYFKYLSESISTGSPTCLAKILGIYQVASKHFKGGKESKMDLLVMENLLFRRNITRLYDLKGSSRSRYNADTSGSNKVLLDQNLIEAMPTSPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWDKHLETWVKTSGILGGPKNTSPTVISPQQYKKRFRKAMTTYFL 605
            E +S + F PAYF Y+S+      PT L KI G Y+V  ++   G   K D+++MEN+ +    +R++DLKGS R+R+   T   ++VLLD+NL+E +  SPIFV  + K LL   +WNDT FL+ +++MDYSL+VGID  K EL +GIIDF+R YTWDK LE+WVK  G++G  +   PT+++P+QYK RFRKAM  Y L
Sbjct: 1719 ESDSLLNFAPAYFDYISKVFFHELPTALTKIFGFYRVDIRNPTTGTICKTDIMIMENVFYDECPSRIFDLKGSMRNRHVESTGKVDEVLLDENLVELIYESPIFVSEQLKSLLHSCLWNDTLFLSKLNIMDYSLIVGIDYTKKELYVGIIDFIRTYTWDKKLESWVKEKGLVG--RGPEPTIVTPKQYKNRFRKAMDCYIL 1917          
BLAST of DC900052 vs. ExPASy Swiss-Prot
Match: FYV1_HUMAN (1-phosphatidylinositol-3-phosphate 5-kinase OS=Homo sapiens GN=PIKFYVE PE=1 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 1.570e-50
Identity = 97/211 (45.97%), Postives = 149/211 (70.62%), Query Frame = 3
Query:    3 ELESFIKFGPAYFKYLSESISTGSPTCLAKILGIYQVASKHFKGGKESKMDLLVMENLLFRRNITRLYDLKGSSRSRYNADTSGSNK---VLLDQNLIEAMPTSPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWDKHLETWVKTSGILGGPKNTSPTVISPQQYKKRFRKAMTTYFLMLPEQWT 626
            E++SF+ F P YF Y++ ++    PT LAKILG+Y++  K+ +   E K+DLLVMENL + R + +++DLKGS R+R     +G      VLLD+NL++ +  +P+++ S +K +L  ++ +D+ FL+S  ++DYSLLVG D+  +ELV+GIID++R +TWDK LE  VK++GILGG +   PTV+SP+ Y+ RF +AM  YFLM+P+ WT
Sbjct: 1883 EVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRTFTWDKKLEMVVKSTGILGG-QGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWT 2092          
BLAST of DC900052 vs. ExPASy Swiss-Prot
Match: FYV1_MOUSE (1-phosphatidylinositol-3-phosphate 5-kinase OS=Mus musculus GN=Pikfyve PE=1 SV=2)

HSP 1 Score: 199.519 bits (506), Expect = 2.051e-50
Identity = 97/211 (45.97%), Postives = 148/211 (70.14%), Query Frame = 3
Query:    3 ELESFIKFGPAYFKYLSESISTGSPTCLAKILGIYQVASKHFKGGKESKMDLLVMENLLFRRNITRLYDLKGSSRSRYNADTSGSNK---VLLDQNLIEAMPTSPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWDKHLETWVKTSGILGGPKNTSPTVISPQQYKKRFRKAMTTYFLMLPEQWT 626
            E++SF+ F P YF Y++ ++    PT LAKILG+Y++  K+ +   E K+DLLVMENL + R + +++DLKGS R+R     +G      VLLD+NL++ +  +P+++ S +K +L  ++ +D  FL+S  ++DYSLLVG D+  +ELV+GIID++R +TWDK LE  VK++GILGG +   PTV+SP+ Y+ RF +AM  YFLM+P+ WT
Sbjct: 1882 EVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHSKSVLRTSIHSDAHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRTFTWDKKLEMVVKSTGILGG-QGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWT 2091          
BLAST of DC900052 vs. ExPASy Swiss-Prot
Match: FYV1_DROME (Putative 1-phosphatidylinositol-3-phosphate 5-kinase OS=Drosophila melanogaster GN=fab1 PE=1 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 2.513e-40
Identity = 90/208 (43.27%), Postives = 135/208 (64.90%), Query Frame = 3
Query:    3 ELESFIKFGPAYFKYLSESISTGSPTCLAKILGIYQVASKHFKGGKESKMDLLVMENLLFRRNITRLYDLKGSSRSRYNADTSGSNK-VLLDQNLIEAMPTSPIFVGSKAKRLLERAVWNDTAFLASIDVMDYSLLVGIDEEKHELVLGIIDFMRQYTWDKHLETWVKTSGILGGPKNTSPTVISPQQYKKRFRKAMTTYFLMLPEQW 623
            ++  F  F P YF+Y+        PT LAKI G+++V+ K  K     +  ++VMENL +  NI   +DLKGS R+R    ++   + VLLD+NL++   + P++V S +K +L  A+  D++FL    VMDYSLLVG+D++   LVLGIID++R +T DK +E+ +K SGILGG K   PTV++P++YK+RF  AM  YFL +P++W
Sbjct: 1599 DMTIFEPFAPKYFEYIDRCQQQQQPTLLAKIFGVFRVSVK--KKDSFVERSVMVMENLFYGCNIENKFDLKGSERNRLVDPSNQQGEIVLLDENLVQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLVGLDKKNGVLVLGIIDYIRTFTLDKRVESIIKGSGILGG-KGKDPTVVNPERYKQRFIDAMDRYFLTVPDRW 1803          
The following BLAST results are available for this feature:
BLAST of DC900052 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
FAB1_YEAST1.199e-5851.201-phosphatidylinositol-3-phosphate 5-kinase FAB1 O... [more]
FYV1_DICDI4.881e-5252.881-phosphatidylinositol-3-phosphate 5-kinase OS=Dic... [more]
FAB1_SCHPO1.202e-5048.261-phosphatidylinositol-3-phosphate 5-kinase fab1 O... [more]
FYV1_HUMAN1.570e-5045.971-phosphatidylinositol-3-phosphate 5-kinase OS=Hom... [more]
FYV1_MOUSE2.051e-5045.971-phosphatidylinositol-3-phosphate 5-kinase OS=Mus... [more]
FYV1_DROME2.513e-4043.27Putative 1-phosphatidylinositol-3-phosphate 5-kina... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900052 VSS Citrus sinensis cDNA clone VS27Q59 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900052 ID=DC900052|Name=DC900052|organism=Citrus sinensis|type=EST|length=877bp
CCGAGTTGGAGTCGTTCATCAAGTTTGGGCCGGCATATTTCAAGTATTTA
TCTGAATCTATTAGTACGGGAAGCCCAACATGCCTGGCAAAGATCTTGGG
TATTTATCAGGTTGCGTCAAAGCACTTTAAAGGAGGGAAGGAATCAAAAA
TGGATCTCTTAGTAATGGAGAATCTTCTCTTTAGGCGCAACATTACACGG
CTTTACGACCTTAAAGGATCATCTCGTTCACGATATAACGCAGATACAAG
CGGTAGTAATAAAGTTCTGCTAGACCAGAATTTGATTGAAGCAATGCCGA
CGTCTCCAATTTTTGTGGGAAGCAAGGCAAAAAGGTTGCTGGAGAGAGCT
GTCTGGAATGATACTGCATTTCTTGCTTCAATTGATGTCATGGACTATTC
TTTGCTTGTTGGCATCGATGAGGAAAAGCACGAGCTGGTGCTTGGGATCA
TTGATTTCATGAGGCAATATACGTGGGACAAGCACCTTGAAACATGGGTG
AAAACCTCGGGCATTCTTGGTGGACCAAAGAACACATCTCCAACTGTGAT
CTCTCCCCAGCAGTACAAGAAACGGTTCAGGAAGGCTATGACAACTTATT
TTCTTATGTTGCCAGAACAGTGGACTCCCCCATCGATCATTCACAGTGGA
TCCCAGTCAGATCTCTGTGAAGAGAACACACACGGTGGTGCCTCCTTTGA
TTGATACTGTAATACTGTATTGTCCATTTTGCCTGTAAATGTGCGAATGA
TAACAGCTCCCTCATTTCCAAAATTTTTTCGTTGGTACTAGGGGTGGATG
CTCGCTGGAGCAACTGTACAATATTTTTTGTAATAGTCAGCGCGCGCACA
CACANTTGCACGCAGTTGTCAGTGTTA
back to top