CN185834

Overview
NameCN185834
Unique NameCN185834
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185834 vs. ExPASy Swiss-Prot
Match: C3H40_ARATH (Zinc finger CCCH domain-containing protein 40 OS=Arabidopsis thaliana GN=At3g21810 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.008e-21
Identity = 67/176 (38.07%), Postives = 91/176 (51.70%), Query Frame = 1
Query:    4 RIKELETQLQKDKEESKRIASKIKKFVKAHNRHSQMQDELKRSQARLQKLGYHLGLDATKVGGNEEDSSINIMSDEETTNYHL---VDPQNEKQTIPSPNKKKLHVDRDTTNGFVPEANLTKDGGRVAE---------------SVHLKEVSRWNQHPTNHGSVADESKLKGKNVS 477
            RI+ELETQL ++K+E +RI S  KKFVK +NR  + QD+LKRS+ARLQKLG  L        GN  D  ++I+SDEET   +L    DP NE Q   S ++KK +VD+ TT   V +  + +      E               S   +E   WN   T + S + E   K +  S
Sbjct:  186 RIQELETQLDREKDECRRITSSSKKFVKEYNRFLRAQDDLKRSEARLQKLGNQLSTYLAGSEGNNRDVGLDIVSDEETNGRNLRTACDPHNELQNTSSLSRKKHYVDQYTTKEPVEDGLIGRGEEEKVENEKKRPPCWNMLSSKSYSEEESGAWNDEDTINRSSSKEDNWKRRRFS 361          
BLAST of CN185834 vs. ExPASy Swiss-Prot
Match: C3H13_ORYSJ (Zinc finger CCCH domain-containing protein 13 OS=Oryza sativa subsp. japonica GN=Os02g0161200 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.862e-18
Identity = 67/201 (33.33%), Postives = 99/201 (49.25%), Query Frame = 1
Query:    4 RIKELETQLQKDKEESKRIASKIKKFVKAHNRHSQMQDELKRSQARLQKLGYHLGLDATKVGGNEEDSSINIMSDEETTNYHLVDPQNEKQTIPSPN-------KKKLHVDRDTT------NGFVPEANLTKDGGRVAESVHLKEVSRWNQHPTNHGSVADESKLKGKNVSTSWFSAQAKNVRSANALALPSTGIAAHVND 567
            ++ +LE QL+++K+E  R+ SK+KKF+KAH R  + Q+E+KRSQAR ++LG  L  D  K G NEE SS+N   +E + N        +K++IP          KK+   D DT          V + + T  G    +S++LK+   W    +  G+     K+KG  V                   LPSTG+AAH  D
Sbjct:  190 KVNDLEVQLRREKDECHRMTSKMKKFIKAHARFLKAQEEVKRSQARFERLGDLLASDILKRGANEEGSSVNEDLNERSPN----TAATKKRSIPYSTSEEAKAVKKRRERDSDTMTRSDKYRSDVTDFDKTSKGTEATKSLYLKK-KLWEDEKSKLGANIFTEKVKGSPVRH----------------VLPSTGMAAHAID 369          
The following BLAST results are available for this feature:
BLAST of CN185834 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
C3H40_ARATH4.008e-2138.07Zinc finger CCCH domain-containing protein 40 OS=A... [more]
C3H13_ORYSJ1.862e-1833.33Zinc finger CCCH domain-containing protein 13 OS=O... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001P02_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001P02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185834 ID=CN185834|Name=CN185834|organism=Citrus sinensis|type=EST|length=696bp
ATGAGAATAAAGGAGCTCGAGACTCAATTGCAGAAAGACAAAGAGGAATC
TAAAAGGATAGCTTCAAAAATCAAGAAGTTTGTCAAAGCACATAATCGTC
ACTCACAGATGCAAGATGAGCTTAAGAGGTCACAAGCTCGACTTCAGAAG
TTGGGATATCATCTTGGCTTGGATGCCACTAAAGTTGGTGGTAATGAAGA
GGATTCAAGCATCAATATCATGAGTGATGAGGAGACCACTAATTACCATC
TAGTCGACCCACAGAATGAGAAGCAGACTATACCTTCTCCGAACAAGAAA
AAACTGCATGTTGATAGGGATACTACTAATGGATTTGTGCCAGAAGCCAA
TTTAACAAAGGATGGAGGACGAGTGGCTGAATCTGTTCACTTAAAGGAGG
TTTCTCGGTGGAATCAGCATCCTACTAATCATGGATCTGTGGCTGATGAA
AGCAAGCTGAAAGGGAAAAATGTCTCAACCAGCTGGTTTTCCGCACAGGC
GAAGAATGTGAGATCAGCAAATGCATTAGCGTTACCATCAACTGGTATAG
CTGCTCATGTCAATGATGAAGAAATAGAAGTTGAAGTGGAGCAGATTGAG
GAGATTGATATGGCTTCAGCTGGAACTGGAAAAGGAGCAACTTACATGGC
AAAAGGCTTGCAATTTAGGCTGCCCCCTCCTCTTCCAATCCCTCGT
back to top