CN185832

Overview
NameCN185832
Unique NameCN185832
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN185832_ssr5 microsatellite CN185832_ssr5:5..16. BLAST: Citrus ESTs to Prunus persica proteins V1
CN185832_ssr17 microsatellite CN185832_ssr17:17..40. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig12563 contig Csv1_Contig12563:23..752. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185832 vs. ExPASy Swiss-Prot
Match: BLC_CITFR (Outer membrane lipoprotein blc OS=Citrobacter freundii PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.415e-17
Identity = 56/155 (36.13%), Postives = 82/155 (52.90%), Query Frame = 3
Query:  129 KEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGAD-TRATYTLNEDGTVHVRNETWSDGKR--GSIEGTAY-KADPKSDEAKLXXXXXXXXXXXXXXXXGNYWVLYIDDNYQYALIGEPTRKYLWILCREPHMDEAIYNQLVEKATSEGYDVSKL 581
            K + VV   D KRY+G WYEIA F  R +   G D   ATY+L +DG ++V N+ ++  +      EG AY   DP +   K+                G Y V+ +D  Y++AL+  P R YLWIL R P + + +  Q++  AT EG++V+KL
Sbjct:   26 KGVTVVNNFDAKRYLGTWYEIARFDHRFE--RGLDKVTATYSLRDDGGINVINKGYNPDREMWQKTEGKAYFTGDPSTAALKVSFFGPFY---------GGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEMKQQMLAIATREGFEVNKL 169          
BLAST of CN185832 vs. ExPASy Swiss-Prot
Match: YR877_MIMIV (Putative lipocalin R877 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R877 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.430e-16
Identity = 56/157 (35.67%), Postives = 81/157 (51.59%), Query Frame = 3
Query:  123 SKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLXXXXXXXXXXXXXXXXGNYWVLYIDDNYQYALI--GEPTRKYLWILCREPHMDEAIYNQLVEKATSEGYDVSKLHR 587
            SK+++     LDI+RYMG WYEIA  P+  Q K   ++ A Y L E   + V N    +G+  S+ GTA  A   +                       Y V++ID+NYQYA++  G  T   LWIL R  +++++ YNQLV    ++GYDV+ L R
Sbjct:   18 SKRDVVSQSSLDIQRYMGTWYEIARLPTSFQ-KGCVNSTANYQLLEPNKIQVTNNCEINGRINSVTGTAIPA--ANTRIVSGFLTPASLMVNFGYGFSPYNVIFIDENYQYAIVSGGNDT---LWILSRFKNINQSTYNQLVTIVYNQGYDVNNLIR 168          
BLAST of CN185832 vs. ExPASy Swiss-Prot
Match: BLC_ECOLI (Outer membrane lipoprotein blc OS=Escherichia coli (strain K12) GN=blc PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.064e-15
Identity = 52/148 (35.14%), Postives = 75/148 (50.68%), Query Frame = 3
Query:  141 VVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSD--GKRGSIEGTAYKADPKSDEAKLXXXXXXXXXXXXXXXXGNYWVLYIDDNYQYALIGEPTRKYLWILCREPHMDEAIYNQLVEKATSEGYDVSK 578
            VV   D KRY+G WYEIA F  R + +      ATY+L +DG ++V N+ ++   G     EG AY     +  A                  G Y V+ +D  Y++AL+  P R YLWIL R P + + +  +++  AT EG+DVSK
Sbjct:   30 VVNNFDAKRYLGTWYEIARFDHRFE-RGLEKVTATYSLRDDGGLNVINKGYNPDRGMWQQSEGKAYFTGAPTRAA--------LKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEVKQEMLAVATREGFDVSK 168          
BLAST of CN185832 vs. ExPASy Swiss-Prot
Match: BLC_ECO57 (Outer membrane lipoprotein blc OS=Escherichia coli O157:H7 GN=blc PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.064e-15
Identity = 52/148 (35.14%), Postives = 75/148 (50.68%), Query Frame = 3
Query:  141 VVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSD--GKRGSIEGTAYKADPKSDEAKLXXXXXXXXXXXXXXXXGNYWVLYIDDNYQYALIGEPTRKYLWILCREPHMDEAIYNQLVEKATSEGYDVSK 578
            VV   D KRY+G WYEIA F  R + +      ATY+L +DG ++V N+ ++   G     EG AY     +  A                  G Y V+ +D  Y++AL+  P R YLWIL R P + + +  +++  AT EG+DVSK
Sbjct:   30 VVNNFDAKRYLGTWYEIARFDHRFE-RGLEKVTATYSLRDDGGLNVINKGYNPDRGMWQQSEGKAYFTGAPTRAA--------LKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEVKQEMLAVATREGFDVSK 168          
BLAST of CN185832 vs. ExPASy Swiss-Prot
Match: BLC_VIBCH (Outer membrane lipoprotein blc OS=Vibrio cholerae GN=blc PE=3 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.808e-11
Identity = 40/154 (25.97%), Postives = 73/154 (47.40%), Query Frame = 3
Query:  129 KEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSD--GKRGSIEGTAYKADPKSDEAKLXXXXXXXXXXXXXXXXGNYWVLYID-DNYQYALIGEPTRKYLWILCREPHMDEAIYNQLVEKATSEGYDVSKL 581
            + ++ V   ++  Y+G+WYE+A     +  +  +   A Y +  DG + V N  +S+  G+    EG AY  +  +D                    G+Y V  +D +NY YA +  P  +YLW+L R P ++  I ++ +E +   G+D ++L
Sbjct:   21 ESVKPVSDFELNNYLGKWYEVARL-DHSFERGLSQVTAEYRVRNDGGISVLNRGYSEEKGEWKEAEGKAYFVNGSTD--------GYLKVSFFGPFYGSYVVFELDRENYSYAFVSGPNTEYLWLLSRTPTVERGILDKFIEMSKERGFDTNRL 165          
BLAST of CN185832 vs. ExPASy Swiss-Prot
Match: APOD_MOUSE (Apolipoprotein D OS=Mus musculus GN=Apod PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.084e-11
Identity = 51/164 (31.10%), Postives = 75/164 (45.73%), Query Frame = 3
Query:  141 VVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS-DGKRGSIEGTAYKADPKSDEAKLXXXXXXXXXXXXXXXXGNYWVLYIDDNYQYALIGEPTR-------KYLWILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQSDNP 608
            V    D+K+Y+GRWYEI   P+  +   G   +A Y+L E+G + V N+  S DG    ++G A K    S+ AKL                  YW+L   D   YAL+   T         ++WIL R P++       L +  TS G D+ K+  T Q++ P
Sbjct:   33 VQENFDVKKYLGRWYEIEKIPASFE--KGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEA-KQSNVSEPAKL------EVQFFPLMPPAPYWIL-ATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCP 186          
The following BLAST results are available for this feature:
BLAST of CN185832 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
BLC_CITFR6.415e-1736.13Outer membrane lipoprotein blc OS=Citrobacter freu... [more]
YR877_MIMIV5.430e-1635.67Putative lipocalin R877 OS=Acanthamoeba polyphaga ... [more]
BLC_ECOLI2.064e-1535.14Outer membrane lipoprotein blc OS=Escherichia coli... [more]
BLC_ECO572.064e-1535.14Outer membrane lipoprotein blc OS=Escherichia coli... [more]
BLC_VIBCH1.808e-1125.97Outer membrane lipoprotein blc OS=Vibrio cholerae ... [more]
APOD_MOUSE3.084e-1131.10Apolipoprotein D OS=Mus musculus GN=Apod PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001O24_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001O24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185832 ID=CN185832|Name=CN185832|organism=Citrus sinensis|type=EST|length=730bp
GAGGAGCAGCAGCAGCAACAACAACAACAACAACAACAACAGGAGCTAGT
ACTCATTCTGATAAACCCAAGCTCTGTTATTCCGAAAAGCAGATTGAAAC
TTTGTCAGCAAAAAAAATGGCCTCCAAGAAAGAGATGGAAGTGGTGAGGG
GTCTTGACATAAAGCGTTACATGGGGAGATGGTATGAGATAGCTTCATTT
CCATCAAGGAATCAGCCCAAGAATGGAGCGGATACGAGGGCTACTTACAC
TTTGAATGAAGATGGGACAGTGCATGTGCGGAATGAGACATGGAGTGATG
GCAAAAGAGGGTCCATCGAAGGCACTGCTTACAAGGCTGATCCTAAGAGC
GATGAGGCCAAGTTGAAGGTCAAGTTTTATGTGCCACCCTTTTTCCCCAT
CATCCCTGTTGTTGGCAACTACTGGGTTTTGTATATTGATGATAATTATC
AGTATGCTTTGATTGGTGAGCCTACCAGGAAATATCTCTGGATTTTATGC
AGGGAGCCTCATATGGATGAAGCGATCTACAATCAGCTAGTGGAGAAGGC
TACAAGTGAAGGGTATGATGTGAGCAAACTGCACAGAACACCACAGAGTG
ATAACCCACCAGAGGCAGAAGAAAGCCCCCAGGACACCAAAGGCATTTGG
TGGATCAAATCCATTTTCGGGAAATAACCATGTAAATTAAATTAAGCATA
ATCTGGGATTTCACCTTTCAAGTATAATAT
back to top