DC900050

Overview
NameDC900050
Unique NameDC900050
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length611
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900050_ssr53 microsatellite DC900050_ssr53:53..64. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5903 contig Csv1_Contig5903:587..1197. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900050 vs. ExPASy Swiss-Prot
Match: EIF3G_RAT (Eukaryotic translation initiation factor 3 subunit G OS=Rattus norvegicus GN=Eif3g PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.145e-31
Identity = 66/110 (60.00%), Postives = 83/110 (75.45%), Query Frame = 2
Query:   77 GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVDQKTGISRGFGFVNFVNKEDAQRAINKLNGYGYDNLILRVEWATPRTN 397
            G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D+ TG S+GF F++F  +EDA RAI  ++G+GYD+LIL VEWA P TN
Sbjct:  211 GKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN 320          
BLAST of DC900050 vs. ExPASy Swiss-Prot
Match: EIF3G_MOUSE (Eukaryotic translation initiation factor 3 subunit G OS=Mus musculus GN=Eif3g PE=1 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 1.145e-31
Identity = 66/110 (60.00%), Postives = 83/110 (75.45%), Query Frame = 2
Query:   77 GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVDQKTGISRGFGFVNFVNKEDAQRAINKLNGYGYDNLILRVEWATPRTN 397
            G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D+ TG S+GF F++F  +EDA RAI  ++G+GYD+LIL VEWA P TN
Sbjct:  211 GKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN 320          
BLAST of DC900050 vs. ExPASy Swiss-Prot
Match: EIF3G_HUMAN (Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens GN=EIF3G PE=1 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 1.145e-31
Identity = 66/110 (60.00%), Postives = 83/110 (75.45%), Query Frame = 2
Query:   77 GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVDQKTGISRGFGFVNFVNKEDAQRAINKLNGYGYDNLILRVEWATPRTN 397
            G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D+ TG S+GF F++F  +EDA RAI  ++G+GYD+LIL VEWA P TN
Sbjct:  211 GKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN 320          
BLAST of DC900050 vs. ExPASy Swiss-Prot
Match: EIF3G_BOVIN (Eukaryotic translation initiation factor 3 subunit G OS=Bos taurus GN=EIF3G PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.145e-31
Identity = 66/110 (60.00%), Postives = 83/110 (75.45%), Query Frame = 2
Query:   77 GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVDQKTGISRGFGFVNFVNKEDAQRAINKLNGYGYDNLILRVEWATPRTN 397
            G YVPP +R GA R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D+ TG S+GF F++F  +EDA RAI  ++G+GYD+LIL VEWA P TN
Sbjct:  211 GKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN 320          
BLAST of DC900050 vs. ExPASy Swiss-Prot
Match: EIF3G_XENTR (Eukaryotic translation initiation factor 3 subunit G OS=Xenopus tropicalis GN=eif3g PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.330e-31
Identity = 65/110 (59.09%), Postives = 82/110 (74.55%), Query Frame = 2
Query:   77 GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVDQKTGISRGFGFVNFVNKEDAQRAINKLNGYGYDNLILRVEWATPRTN 397
            G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D+ TG S+GF F++F  +EDA RAI  ++G+GYD+LIL VEWA P TN
Sbjct:  201 GKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN 310          
BLAST of DC900050 vs. ExPASy Swiss-Prot
Match: EI3GB_XENLA (Eukaryotic translation initiation factor 3 subunit G-B OS=Xenopus laevis GN=eif3g-B PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.330e-31
Identity = 65/110 (59.09%), Postives = 82/110 (74.55%), Query Frame = 2
Query:   77 GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVDQKTGISRGFGFVNFVNKEDAQRAINKLNGYGYDNLILRVEWATPRTN 397
            G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D+ TG S+GF F++F  +EDA RAI  ++G+GYD+LIL VEWA P TN
Sbjct:  199 GKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN 308          
BLAST of DC900050 vs. ExPASy Swiss-Prot
Match: EI3GA_XENLA (Eukaryotic translation initiation factor 3 subunit G-A OS=Xenopus laevis GN=eif3g-A PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.330e-31
Identity = 65/110 (59.09%), Postives = 82/110 (74.55%), Query Frame = 2
Query:   77 GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVDQKTGISRGFGFVNFVNKEDAQRAINKLNGYGYDNLILRVEWATPRTN 397
            G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D+ TG S+GF F++F  +EDA RAI  ++G+GYD+LIL VEWA P TN
Sbjct:  199 GKYVPPSLRDGGSRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN 308          
BLAST of DC900050 vs. ExPASy Swiss-Prot
Match: EIF3G_DANRE (Eukaryotic translation initiation factor 3 subunit G OS=Danio rerio GN=eif3g PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.266e-30
Identity = 64/110 (58.18%), Postives = 81/110 (73.64%), Query Frame = 2
Query:   77 GTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVDQKTGISRGFGFVNFVNKEDAQRAINKLNGYGYDNLILRVEWATPRTN 397
            G YVPP +R G  R G  M   RR +D  ++RVTNLSEDTRE DL ELFRPFG++SR+Y+A D+ TG S+GF F++F  +EDA RAI  ++G+GYD+LIL VEWA P  N
Sbjct:  184 GKYVPPSLRDGGTRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKNTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSNN 293          
BLAST of DC900050 vs. ExPASy Swiss-Prot
Match: EIF3G_NEMVE (Eukaryotic translation initiation factor 3 subunit G OS=Nematostella vectensis GN=v1g171563 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.827e-29
Identity = 63/111 (56.76%), Postives = 82/111 (73.87%), Query Frame = 2
Query:   71 TKGTYVPPGMRAGAERTGTDM---RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVDQKTGISRGFGFVNFVNKEDAQRAINKLNGYGYDNLILRVEWATPRT 394
            T G YV PG+R GA R G  M    +R++  ++RVTNLSE+TRE DL ELFRP G +SR+++A D+ T  S+GF F+NFV++EDA RAI  L+G+GYD+LIL VEWA P T
Sbjct:  182 TSGKYVAPGLRDGANRRGETMPSRSQRDETATIRVTNLSEETRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINFVHREDAARAIEVLSGFGYDHLILNVEWAKPST 292          
BLAST of DC900050 vs. ExPASy Swiss-Prot
Match: EIF3G_USTMA (Eukaryotic translation initiation factor 3 subunit G OS=Ustilago maydis GN=TIF35 PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 6.083e-25
Identity = 59/110 (53.64%), Postives = 74/110 (67.27%), Query Frame = 2
Query:   77 GTYVPPGMRAGAERTGTDM-----RRRNDENSVRVTNLSEDTREPDLLELFRPFGAVSRVYVAVDQKTGISRGFGFVNFVNKEDAQRAINKLNGYGYDNLILRVEWATPR 391
            G YVPP MR GA+  G  M       R+D  ++RVTNLSED  + DL ELF  FG V RVYV  D++TGI +G+ FV+F N+EDA RA  K++G GYDNLIL  +W+ PR
Sbjct:  195 GKYVPPSMRGGAKGPGEKMGGLGGMSRDDLPTLRVTNLSEDADDDDLRELFMRFGRVVRVYVGRDRETGICKGYAFVSFENREDADRARQKVDGRGYDNLILSCQWSLPR 304          
The following BLAST results are available for this feature:
BLAST of DC900050 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 71
Match NameE-valueIdentityDescription
EIF3G_RAT1.145e-3160.00Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_MOUSE1.145e-3160.00Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_HUMAN1.145e-3160.00Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_BOVIN1.145e-3160.00Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_XENTR3.330e-3159.09Eukaryotic translation initiation factor 3 subunit... [more]
EI3GB_XENLA3.330e-3159.09Eukaryotic translation initiation factor 3 subunit... [more]
EI3GA_XENLA3.330e-3159.09Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_DANRE1.266e-3058.18Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_NEMVE1.827e-2956.76Eukaryotic translation initiation factor 3 subunit... [more]
EIF3G_USTMA6.083e-2553.64Eukaryotic translation initiation factor 3 subunit... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900050 VSS Citrus sinensis cDNA clone VS27Q56 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900050 ID=DC900050|Name=DC900050|organism=Citrus sinensis|type=EST|length=611bp
TGCTGCTCCAGCTGAGACATTCATTGATAAACCAGCTGCATCAGAGACTG
CAGCTGCTGCTGCTGGCGCGACCAAGGGAACATATGTTCCTCCTGGCATG
AGAGCAGGGGCGGAGAGAACTGGAACTGATATGAGACGCAGGAATGATGA
GAACTCTGTTAGGGTCACCAACCTATCGGAGGACACTCGGGAACCTGACT
TGCTTGAGCTCTTCCGGCCTTTTGGTGCTGTTAGCCGAGTTTATGTTGCT
GTTGATCAGAAGACTGGCATAAGCAGAGGTTTTGGTTTTGTGAACTTTGT
GAACAAGGAAGATGCTCAGAGAGCTATCAACAAACTGAATGGCTATGGTT
ATGACAATCTCATCCTCAGAGTTGAATGGGCCACTCCAAGGACTAACTAG
ATCGATCTATTTATCCTTGAGCTTTAACGGGATACAATATCAATTTTGTG
TATTATTTTATACTATCTTAAGTATTGAATGATCTTGGAGTGTTTTGTTG
AGAGACTATGGCTTTCCTACAAGTACTTTGTACTCGAGATGATTTAATTT
ATGCCGTAGGTTCAATGTTTTTCAATGTTATTTGATNTCTAATAAGATAC
CAGGCAACACT
back to top