DC900049

Overview
NameDC900049
Unique NameDC900049
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length622
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:637..1258. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXD2_ARATH (Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 7.514e-47
Identity = 91/139 (65.47%), Postives = 113/139 (81.29%), Query Frame = -3
Query:  207 ISNKTSNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKD-EYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGDA 620
            +S K+ +D+D IRIL TRSKAQ+ ATLN Y N YGN I+++L+ +  D +Y+ LLRA + CL  PE +FEK+LRL+INK GTDE  LTRVVTTR EVD++ IK+EYQRRNS+PLDRA+ KDTSGDYE ML+ALLGHGDA
Sbjct:  179 VSEKSYSDDDFIRILTTRSKAQLGATLNHYNNEYGNAINKNLKEESDDNDYMKLLRAVITCLTYPEKHFEKVLRLSINKMGTDEWGLTRVVTTRTEVDMERIKEEYQRRNSIPLDRAIAKDTSGDYEDMLVALLGHGDA 317          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXD1_ARATH (Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.674e-46
Identity = 93/139 (66.91%), Postives = 115/139 (82.73%), Query Frame = -3
Query:  207 ISNKTSNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLE-ADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGDA 620
            I +K  NDED+IRIL+TRSKAQINAT N+Y++ +G +I + LE  D  D++L LLR+T+QCL RPE YF  +LR AINK GTDEGALTR+VTTRAE+DLKVI +EYQRRNS+PL++A+ KDT GDYEKML+ALLG  DA
Sbjct:  179 IKDKHYNDEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDDDDKFLALLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGEEYQRRNSIPLEKAITKDTRGDYEKMLVALLGEDDA 317          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXD6_ARATH (Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 8.308e-46
Identity = 91/138 (65.94%), Postives = 110/138 (79.71%), Query Frame = -3
Query:  207 ISNKTSNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGDA 620
            I+ K   DEDLIRIL TRSKAQINATLN +K+ +G+ I++ L+ D  D+Y+ LL+  ++CL  PE YFEK+LR AIN+ GTDE ALTRVVTTRAEVDL+ IK+EY RRNSVPLDRA+  DTSGDY+ MLLALLGH  A
Sbjct:  181 ITEKAYTDEDLIRILTTRSKAQINATLNHFKDKFGSSINKFLKEDSNDDYVQLLKTAIKCLTYPEKYFEKVLRRAINRMGTDEWALTRVVTTRAEVDLERIKEEYLRRNSVPLDRAIANDTSGDYKDMLLALLGHDHA 318          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXD7_ARATH (Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 4.559e-44
Identity = 89/138 (64.49%), Postives = 107/138 (77.54%), Query Frame = -3
Query:  207 ISNKTSNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGDA 620
            I  K   D+DLIRIL TRSKAQI+ATLN YKN +G  + + L+ D ++EY+ LL+A ++CL  PE YFEK+LR AINK GTDE  LTRVVTTRAE D++ IK+EY RRNSVPLDRA+ KDT GDYE +LLALLGH  A
Sbjct:  179 IKEKAYADDDLIRILTTRSKAQISATLNHYKNNFGTSMSKYLKEDSENEYIQLLKAVIKCLTYPEKYFEKVLRQAINKLGTDEWGLTRVVTTRAEFDMERIKEEYIRRNSVPLDRAIAKDTHGDYEDILLALLGHDHA 316          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANX4_FRAAN (Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 1.797e-32
Identity = 70/137 (51.09%), Postives = 97/137 (70.80%), Query Frame = -3
Query:  210 ISNKTSNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 620
            I +K  N E++IRIL+TRSK Q+ AT N+Y++  G  I ++L  +  +++   L   ++CL  P+ YFEK+LR AI + GTDE ALTRV+ TRAE DL+ IK+ Y ++NSVPL++AV KDTSGDY+  LL LLG  D
Sbjct:  178 IKDKAFNHEEIIRILSTRSKTQLMATFNKYRDDQGISISKNLLEEGANDFQKALHTAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRAERDLRDIKEVYYKKNSVPLEQAVAKDTSGDYKAFLLTLLGKED 314          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXD3_ARATH (Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 9.250e-21
Identity = 53/135 (39.26%), Postives = 79/135 (58.52%), Query Frame = -3
Query:  219 ISNKTSNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYL-DLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 620
            I  K  + + ++ IL TRS  Q+  T   YK  YG  ID+D++  P D  L  LL+  + C+  PE +F K++R +I   GTDE +LTR + TRAE+DL  ++ EY    +  +D A+  D SGDY+  ++ LLG
Sbjct:  184 IEKKQLDHDHVLYILGTRSIYQLRETFVAYKKNYGVTIDKDVDGCPGDADLRSLLKVAIFCIDTPEKHFAKVVRDSIEGFGTDEDSLTRAIVTRAEIDLMKVRGEYFNMYNTSMDNAITGDISGDYKDFIITLLG 318          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANX10_DROME (Annexin-B10 OS=Drosophila melanogaster GN=AnnX PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.477e-18
Identity = 49/132 (37.12%), Postives = 79/132 (59.85%), Query Frame = -3
Query:  219 KTSNDEDLI-RILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 611
            K   DE++  RI++  S  Q+     +YK + G  I+Q ++ +  DE  + + A V+C+  P  +F   L  A+N  GTD+  L R++ +R+E+DL+ IK E++R  +  L  AVV +TSGDY++ L ALLG
Sbjct:  187 KLGTDEEVFNRIMSHASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFANRLYKAMNGAGTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVAETSGDYKRALTALLG 318          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXD5_ARATH (Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 1.633e-17
Identity = 47/129 (36.43%), Postives = 75/129 (58.14%), Query Frame = -3
Query:  219 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 605
            S+D+ LI+I   RS+  + A  + Y+++YG ++ + +  + +  +  +L   +QC      YF K LR ++   GTD+ AL R+V TRAEVD++ I  EY++R    L  AV  DT+  Y   LL+LLG
Sbjct:  185 SDDQTLIQIFTDRSRTHLVAVRSTYRSMYGKELGKAIRDETRGNFEHVLLTILQCAENSCFYFAKALRKSMKGLGTDDTALIRIVVTRAEVDMQFIITEYRKRYKKTLYNAVHSDTTSHYRTFLLSLLG 313          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA3_MOUSE (Annexin A3 OS=Mus musculus GN=Anxa3 PE=2 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 1.382e-16
Identity = 46/136 (33.82%), Postives = 72/136 (52.94%), Query Frame = -3
Query:  210 NKTSNDED-LIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            NK   DED    +L  RS  Q+  T ++Y+N+   DI+  ++ +    + DLL A V C      +  + L  A+   GTDE  L R++ +R+E+DL  I+ E+++     L  A+  DTSGDY  +LL + G  D
Sbjct:  188 NKWGTDEDKFTEVLCLRSFPQLKLTFDEYRNISQKDIEDSIKGELSGHFEDLLLAIVHCARNTPAFLAERLHQALKGAGTDEFTLNRIMVSRSEIDLLDIRHEFKKHYGYSLYSAIQSDTSGDYRTVLLKICGEDD 323          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANX13_MOUSE (Annexin A13 OS=Mus musculus GN=Anxa13 PE=2 SV=3)

HSP 1 Score: 85.5001 bits (210), Expect = 2.358e-16
Identity = 46/120 (38.33%), Postives = 68/120 (56.67%), Query Frame = -3
Query:  222 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALL 581
            +LA RS  Q+ AT   Y+ + G D+++ +E +   +        V+C    E YF  +L  A+   GTDE  L R++ TRAEVDL+ IK ++Q +    L   V  DTSGD+ K+L+ALL
Sbjct:  197 VLAKRSYKQLRATFQAYQILIGKDMEETIEEETSGDLKKAYLTIVRCAQDLEGYFADLLYKAMKGMGTDEETLIRIIVTRAEVDLQGIKAKFQEKYQKSLSDMVHSDTSGDFRKLLVALL 316          

HSP 2 Score: 67.3958 bits (163), Expect = 6.644e-11
Identity = 37/128 (28.91%), Postives = 70/128 (54.69%), Query Frame = -3
Query:  222 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALL 605
            +++  +I +L++R+  +      +YK  YG D+++ L ++    +    +  +  L RP  Y  + L+ A+   GTDE  L  ++ TR+  ++  IK+ YQR     L+  V +DTSG+  K+L++LL
Sbjct:   33 TDEAAIIEVLSSRTSEERQQIKQKYKEKYGKDLEEVLNSELSGNFK---KTALALLDRPNEYAARQLQKAMKGVGTDEAMLIEILCTRSNKEIVAIKEAYQRLFGRSLESDVKEDTSGNLRKILVSLL 157          
The following BLAST results are available for this feature:
BLAST of DC900049 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
ANXD2_ARATH7.514e-4765.47Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV... [more]
ANXD1_ARATH1.674e-4666.91Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV... [more]
ANXD6_ARATH8.308e-4665.94Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV... [more]
ANXD7_ARATH4.559e-4464.49Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 ... [more]
ANX4_FRAAN1.797e-3251.09Annexin-like protein RJ4 OS=Fragaria ananassa PE=2... [more]
ANXD3_ARATH9.250e-2139.26Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV... [more]
ANX10_DROME1.477e-1837.12Annexin-B10 OS=Drosophila melanogaster GN=AnnX PE=... [more]
ANXD5_ARATH1.633e-1736.43Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV... [more]
ANXA3_MOUSE1.382e-1633.82Annexin A3 OS=Mus musculus GN=Anxa3 PE=2 SV=3[more]
ANX13_MOUSE2.358e-1638.33Annexin A13 OS=Mus musculus GN=Anxa13 PE=2 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900049 VSS Citrus sinensis cDNA clone VS27Q55 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900049 ID=DC900049|Name=DC900049|organism=Citrus sinensis|type=EST|length=622bp
AAAGTAGCAGTTTCATANCAAATGCTGTCACCATCTTATTTATAAGATCA
TAGATTAAGTTTTTCAACCGGCATAACCAAAAGACTGAAAATAAAACGAT
CATCACACATGGATAGAGAACACTGCAAACTCCAAGCAACAGCAAACCTA
GATAAATAAAACACATATATTGCCTCTCAATCCTTCAAGAAATAGGGAAC
AACTCAAGCATCCCCATGTCCTAAAAGTGCCAGAAGCATTTTTTCGTAGT
CCCCAGAGGTGTCCTTGACAACGGCGCGATCCAGAGGAACACTGTTCCTC
CTCTGGTACTCATCTTTTATGACCTTCAAGTCGACCTCGGCCCTTGTGGT
GACGACTCTAGTAAGAGCCCCTTCATCTGTTCCCTGTTTGTTAATTGCCA
GACGAAGTATCTTCTCAAAATAATGTTCAGGGCGGACTAAGCACTGAACT
GTGGCCCTCAGTAGGTCGAGGTACTCATCTTTAGGGTCAGCCTCTAAGTC
CTGATCAATATCATTCCCATATACATTCTTGTATTGATTCAGAGTCGCAT
TGATCTGNGCTTTGCTCCTTGTAGCCAAGATCCTGATGAGATCCTCATCA
TTGGAGGTCTTATTCGAAATCT
back to top