DC900048

Overview
NameDC900048
Unique NameDC900048
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:7..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXD1_ARATH (Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.330e-63
Identity = 113/147 (76.87%), Postives = 129/147 (87.76%), Query Frame = 3
Query:   99 MSTLTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            M+TL V   VP+ ++D EQLR AFEGWGTNE LIISILAHR+A QRK+IRQ Y +TYGEDLLK+LDKEL+NDFER ++LWTL+P ERDA LANEATKRWTSSNQVLME+ACTR+S QLL ARQAYHAR+KKSLEEDV +HT GDFRK
Sbjct:    1 MATLKVSDSVPAPSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGEDLLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAYHARYKKSLEEDVAHHTTGDFRK 147          

HSP 2 Score: 26.5646 bits (57), Expect = 1.330e-63
Identity = 11/17 (64.71%), Postives = 13/17 (76.47%), Query Frame = 2
Query:  548 TLVTXYRYEGDEXTLHL 598
            +LVT YRYEGDE  + L
Sbjct:  151 SLVTSYRYEGDEVNMTL 167          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXD2_ARATH (Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.075e-53
Identity = 100/147 (68.03%), Postives = 121/147 (82.31%), Query Frame = 3
Query:   99 MSTLTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            M++L VP+ VP   +D EQL KAF GWGTNE+LIISILAHRNAAQR LIR  YA TY EDLLK+LDKEL++DFER VMLWTLDP ERDA+LA E+TK +T +N VL+EIACTR + +L++ +QAY AR+KKS+EEDV  HT+GD RK
Sbjct:    1 MASLKVPSNVPLPEDDAEQLHKAFSGWGTNEKLIISILAHRNAAQRSLIRSVYAATYNEDLLKALDKELSSDFERAVMLWTLDPPERDAYLAKESTKMFTKNNWVLVEIACTRPALELIKVKQAYQARYKKSIEEDVAQHTSGDLRK 147          

HSP 2 Score: 21.9422 bits (45), Expect = 1.075e-53
Identity = 8/16 (50.00%), Postives = 12/16 (75.00%), Query Frame = 2
Query:  551 LVTXYRYEGDEXTLHL 598
            LV+ +RYEGD+  + L
Sbjct:  152 LVSTFRYEGDDVNMML 167          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXD7_ARATH (Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 4.400e-52
Identity = 98/147 (66.67%), Postives = 117/147 (79.59%), Query Frame = 3
Query:   99 MSTLTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            M++L VPA VP   ED EQL KAF+GWGTNE++IISILAHRNA QR  IR  YA  Y +DLLK LD+EL+ DFER VMLWT +PAERDA+LA E+TK +T +N VL+EIACTRS+ +L  A+QAY AR+K SLEEDV YHT+GD RK
Sbjct:    1 MASLKVPATVPLPEEDAEQLYKAFKGWGTNERMIISILAHRNATQRSFIRAVYAANYNKDLLKELDRELSGDFERAVMLWTFEPAERDAYLAKESTKMFTKNNWVLVEIACTRSALELFNAKQAYQARYKTSLEEDVAYHTSGDIRK 147          

HSP 2 Score: 21.9422 bits (45), Expect = 4.400e-52
Identity = 8/16 (50.00%), Postives = 12/16 (75.00%), Query Frame = 2
Query:  551 LVTXYRYEGDEXTLHL 598
            LV+ +RY+GDE  + L
Sbjct:  152 LVSTFRYDGDEVNMTL 167          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXD6_ARATH (Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 4.619e-50
Identity = 95/147 (64.63%), Postives = 114/147 (77.55%), Query Frame = 3
Query:   99 MSTLTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            M++L +PA +P   ED EQL KAF+GWGTNE +IISILAHRNA QR  IR  YA  Y +DLLK LD EL+ DFERVVMLWTLDP ERDA+LANE+TK +T +  VL+EIACTR S +  + +QAYH R+K SLEEDV YHT+G+ RK
Sbjct:    1 MASLKIPANIPLPEEDSEQLHKAFKGWGTNEGMIISILAHRNATQRSFIRAVYAANYNKDLLKELDGELSGDFERVVMLWTLDPTERDAYLANESTKLFTKNIWVLVEIACTRPSLEFFKTKQAYHVRYKTSLEEDVAYHTSGNIRK 147          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX4_FRAAN (Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 9.665e-39
Identity = 81/147 (55.10%), Postives = 99/147 (67.35%), Query Frame = 3
Query:   99 MSTLTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            M+TL  P       ED E LRK+ +GWGTNE+ IISIL HRNA QRK IR  Y   Y EDLLK L+ EL+ DFE+ V  WTLDPA+RDA LAN A K+ T    V++EI+C  S ++LL  R+AY  R+K S+EED+  HT GD RK
Sbjct:    1 MATLVSPPNF-CAKEDAEALRKSVKGWGTNEKAIISILGHRNAGQRKEIRAAYEQLYQEDLLKPLESELSGDFEKAVYRWTLDPADRDAVLANVAIKKSTDVYNVIIEISCIHSPEELLAVRRAYQLRYKHSVEEDLAAHTTGDIRK 146          

HSP 2 Score: 21.557 bits (44), Expect = 9.665e-39
Identity = 9/16 (56.25%), Postives = 10/16 (62.50%), Query Frame = 2
Query:  551 LVTXYRYEGDEXTLHL 598
            LVT YRY+G E    L
Sbjct:  151 LVTAYRYDGHEINAKL 166          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXD3_ARATH (Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 2.913e-28
Identity = 62/142 (43.66%), Postives = 93/142 (65.49%), Query Frame = 3
Query:   99 MSTLTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLAN-----EATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDV 509
            M+T+ VP +VPS  +D E L++A  GWGT+E+ II +L  R+ +QR+ IR+++ + YG+DL+  L  EL+ DF + V+ WT DPAERDA L N     E  K+   + +V++EI+CT S   L+  R+AY + F  SLEE +
Sbjct:    1 MATIRVPNEVPSPAQDSETLKQAIRGWGTDEKAIIRVLGQRDQSQRRKIRESFREIYGKDLIDVLSSELSGDFMKAVVSWTYDPAERDARLVNKILNKEKKKKSLENLKVIVEISCTTSPNHLIAVRKAYCSLFDSSLEEHI 142          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXD5_ARATH (Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 3.938e-25
Identity = 58/147 (39.46%), Postives = 86/147 (58.50%), Query Frame = 3
Query:   99 MSTLTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            M+T+ +P  VPS   D +QL KAF+G G +  +II+ILAHRNA QR LI Q Y   + +DL K L  EL    ++ V+LW  +  ERDA +   + +   + ++ + EI CTRS  QL + +Q Y   F   LEED+    +G+ ++
Sbjct:    1 MATMKIPMTVPSPRVDADQLFKAFKGRGCDTSVIINILAHRNATQRALIEQEYETKFSDDLRKRLHSELHGHLKKAVLLWMPEAVERDASILKRSLRGAVTDHKAIAEIICTRSGSQLRQIKQVYSNTFGVKLEEDIESEASGNHKR 147          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA3_MOUSE (Annexin A3 OS=Mus musculus GN=Anxa3 PE=2 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 1.004e-20
Identity = 58/141 (41.13%), Postives = 83/141 (58.87%), Query Frame = 3
Query:  117 PAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            P   PSV  D E +RKA  G GT+E+ +I+IL  R+ AQR+LI + Y   Y ++L   L  +L+  FE V++     PA  DA    ++ K   +    L+EI  TRSS+Q+ E  QAY+  +KKSL +D+   T+GDFRK
Sbjct:   16 PGFSPSV--DAEAIRKAIRGLGTDEKTLINILTERSNAQRQLIVKQYQAAYEQELKDDLKGDLSGHFEHVMVALVTAPALFDANELKKSMKGTGTDEDALIEILTTRSSRQMKEISQAYYTVYKKSLGDDISSETSGDFRK 154          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA3_HUMAN (Annexin A3 OS=Homo sapiens GN=ANXA3 PE=1 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 1.004e-20
Identity = 55/137 (40.15%), Postives = 85/137 (62.04%), Query Frame = 3
Query:  129 PSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            PSV  D E ++KA  G GT+E+++ISIL  R+ AQR+LI + Y   YG++L   L  +L+  FE +++     PA  DA    ++ K   ++   L+EI  TR+S+Q+ +  QAY+  +KKSL +D+   T+GDFRK
Sbjct:   20 PSV--DAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSGDFRK 154          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA7_MACFA (Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.236e-20
Identity = 48/141 (34.04%), Postives = 86/141 (60.99%), Query Frame = 3
Query:  117 PAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            PA       D E LRKA +G+GT+EQ I+ ++A+R+  QR+ I+  +  +YG+DL+K L  EL+ + E +++   + P   DA+   +A +   +  +VL+EI CTR+++++ E  + Y + F + LE+D+   T+G F +
Sbjct:  181 PAANFDAMRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWTLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFER 321          
The following BLAST results are available for this feature:
BLAST of DC900048 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
ANXD1_ARATH1.330e-6376.87Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV... [more]
ANXD2_ARATH1.075e-5368.03Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV... [more]
ANXD7_ARATH4.400e-5266.67Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 ... [more]
ANXD6_ARATH4.619e-5064.63Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV... [more]
ANX4_FRAAN9.665e-3955.10Annexin-like protein RJ4 OS=Fragaria ananassa PE=2... [more]
ANXD3_ARATH2.913e-2843.66Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV... [more]
ANXD5_ARATH3.938e-2539.46Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV... [more]
ANXA3_MOUSE1.004e-2041.13Annexin A3 OS=Mus musculus GN=Anxa3 PE=2 SV=3[more]
ANXA3_HUMAN1.004e-2040.15Annexin A3 OS=Homo sapiens GN=ANXA3 PE=1 SV=3[more]
ANXA7_MACFA2.236e-2034.04Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900048 VSS Citrus sinensis cDNA clone VS27Q55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900048 ID=DC900048|Name=DC900048|organism=Citrus sinensis|type=EST|length=644bp
GTCCTTCTTGNGTAGAGAGTCTCGTTCTCGATTCTGCGCAGCACACAGAA
TCAGATTTGAGTTAAGTTCTGAAAGAAGAACAAGGAGATCACGAAACAAT
GTCAACACTTACAGTTCCAGCGCAAGTTCCATCTGTTACCGAAGACTGTG
AGCAGCTCAGAAAAGCCTTTGAAGGATGGGGAACAAACGAGCAACTGATC
ATATCGATACTGGCTCACAGAAATGCTGCTCAACGCAAGTTGATTCGACA
AACATATGCTGATACTTACGGCGAAGACCTCCTCAAGTCGCTCGATAAGG
AACTCACTAATGACTTTGAGAGGGTGGTGATGCTCTGGACTCTTGATCCT
GCTGAACGTGATGCCTTTTTGGCTAATGAAGCCACTAAGAGGTGGACTTC
TAGCAACCAGGTTCTTATGGAAATTGCATGCACCAGGTCTTCGAAGCAAT
TGCTCGAAGCAAGGCAGGCTTATCATGCTCGTTTTAAGAAGTCCCTTGAA
GAGGATGTTGGTTATCACACCAATGGGGACTTCCGCAAGCTTTTGCTACC
CTTGTGACTGNCTACCGATATGAGGGTGATGAGGNGACATTACACTTGCA
AATCAGAAGCTAGATTTCATGAGAGATTCGATAGACTACATGAT
back to top