DC900045

Overview
NameDC900045
Unique NameDC900045
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length579
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10928 contig Csv1_Contig10928:129..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900045 vs. ExPASy Swiss-Prot
Match: GEM1_CRYNE (Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans GN=GEM1 PE=3 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 2.932e-31
Identity = 78/187 (41.71%), Postives = 109/187 (58.29%), Query Frame = 2
Query:   20 DQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPA------AALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFS------ENYAPTTGEQYAVNVVDQPGGNKKTLILQE 544
            D SVEL+    +FL  IF  YD D DGA+   EL+DLF T+P +PW    + D   T  +G +TL+G++++W++ TLL+ R +L  L Y+GY   PA       AL VTR R  DR++++  RNVF C + G   +GK++LL SF+ RPF         Y PTT     VN V+   G +K L+LQE
Sbjct:  333 DCSVELSPLGNQFLTDIFEAYDKDQDGALSQNELDDLFSTSPGNPWLSQGFPDTTITDDMGRVTLQGWLAQWSMTTLLNHRTTLNYLAYLGYSSSPATDLPTPTALHVTRPRKQDRRQRKVTRNVFLCYVLGATGSGKTSLLRSFVNRPFKGGEDGLGGYEPTTKVLSVVNSVEME-GVEKYLVLQE 518          
BLAST of DC900045 vs. ExPASy Swiss-Prot
Match: GEM1_CANGA (Mitochondrial Rho GTPase 1 OS=Candida glabrata GN=GEM1 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 4.234e-30
Identity = 76/189 (40.21%), Postives = 114/189 (60.32%), Query Frame = 2
Query:   17 PDQ-SVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESP--WDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVTRKRSVDRKKQQ------TERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEE 556
            P+Q SVEL+S+   FL  IF  +D DNDGA+   EL  LF + P  P  W E  +  +    A G +TL+G++++W + T LD + + A L+Y+G+  D   A+++T+ R + R++ +      T+R VF C + G +N+GKS+LL SFL R FSE Y+PT   + AVN V+  G  +  LILQE  E+
Sbjct:  310 PEQASVELSSKGYRFLVDIFIKFDSDNDGALNDTELHTLFRSTPGLPNLWLETNFPASTVVNAKGFVTLQGWLAQWTMTTYLDYKITTAYLVYLGFQEDAKLAVQITKSRRMRRRQGRLYRSYVTDRKVFNCFVVGKRNSGKSSLLESFLGRLFSEAYSPTIRPRVAVNNVEVTGDKQYYLILQEFGEQ 498          
BLAST of DC900045 vs. ExPASy Swiss-Prot
Match: GEM1_GIBZE (Mitochondrial Rho GTPase 1 OS=Gibberella zeae GN=GEM1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 3.034e-28
Identity = 69/183 (37.70%), Postives = 107/183 (58.47%), Query Frame = 2
Query:   26 SVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESP--WDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYG-GDP----AAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPE 553
            S EL+     F   +F ++D DNDG +   ELE LF  AP  P  W ++ +  +      G++TL+G++++W++ T ++P+ ++  L Y+G+   +P     AAL++T+ R    +  + ERNV  C + G   AGKSALL+SFL RPF   Y PT   + AVN V+ PGG +  LIL+E+ E
Sbjct:  299 SAELSPAGYRFFVDLFLIFDKDNDGGLNDEELEALFAPAPGLPSSWTDSSFPSSTVRNEAGHVTLQGWLAQWSMTTFIEPKTTIEYLAYLGFEPSNPKDSITAALKITKPRKRRSRLGRVERNVVLCYVLGASGAGKSALLDSFLNRPFYGLYHPTIKPRRAVNSVELPGGKQVYLILEELGE 481          
BLAST of DC900045 vs. ExPASy Swiss-Prot
Match: MIRO2_CHICK (Mitochondrial Rho GTPase 2 OS=Gallus gallus GN=RHOT2 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.828e-28
Identity = 76/189 (40.21%), Postives = 103/189 (54.50%), Query Frame = 2
Query:    8 KLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYG-----GDPAAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPF-SENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEE 556
            +L P  S EL     +FL+ +F  +D D DGA+ PAEL++ F   P  PW    Y     TT  G L+L GF+ +W L+  LD RH L  L Y+GY           AL VTR++ +D +K QT+RNVF C + G + AGKSA L +FL R   ++  +P     Y +N V Q  G +K LIL E+  E
Sbjct:  292 RLPPGCSTELNHLGYQFLQRLFEKHDKDQDGALSPAELQNFFSVFPCMPWGPELYNTVC-TTDKGLLSLHGFLCQWTLIAYLDVRHCLECLGYLGYPILSEQDSQTQALTVTREKRIDLEKGQTQRNVFLCKVLGARGAGKSAFLQAFLGRSLAAQRESPGEPSPYTINTV-QVNGQEKYLILHEVSAE 478          
BLAST of DC900045 vs. ExPASy Swiss-Prot
Match: GEM1_ASHGO (Mitochondrial Rho GTPase 1 OS=Ashbya gossypii GN=GEM1 PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.967e-27
Identity = 70/190 (36.84%), Postives = 103/190 (54.21%), Query Frame = 2
Query:   11 LSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESP--WDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVTRKRSVDRKK------QQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEE 556
            ++   SVEL+     FL  +F  +D DNDG +   EL  LF   P  P  W E  +  +      G +TL+G+++ W++ T +D + +   L+Y+G+  D   AL VTR R   R+          +R VF C + G  N+GKS+LL SFL RPFSE Y+PT   + AVN ++  GG +  LILQE  ++
Sbjct:  316 ITDTSSVELSPLGYRFLVDVFLAFDKDNDGGLNEDELNVLFKCTPGLPKLWSETCFPYSTVVNNRGFITLQGWLAHWSMTTFIDYKTTTEYLVYLGFEKDAKLALHVTRARRKRRRNGIFYRAPVNDRKVFNCYILGKPNSGKSSLLESFLGRPFSETYSPTIRPKIAVNSLELKGGKQYYLILQEFGQQ 505          
BLAST of DC900045 vs. ExPASy Swiss-Prot
Match: GEM1_YEAST (Mitochondrial Rho GTPase 1 OS=Saccharomyces cerevisiae GN=GEM1 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.382e-27
Identity = 72/194 (37.11%), Postives = 107/194 (55.15%), Query Frame = 2
Query:    2 PTKLSPD-QSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESP--WDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVTRKRSVDRKKQQ------TERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEE 556
            P  + PD  SVEL+ +   FL  IF  +DIDNDG +   EL  LF   P  P  W    +  +      G +TL+G++++W++ T L+   + A L+Y G+  D   AL+VT+ R + R+  +       +R VF C + G    GKS+LL +FL R FSE Y+PT   + AVN ++  GG +  LILQE+ E+
Sbjct:  315 PRLVVPDTSSVELSPKGYRFLVDIFLKFDIDNDGGLNNQELHRLFKCTPGLPKLWTSTNFPFSTVVNNKGCITLQGWLAQWSMTTFLNYSTTTAYLVYFGFQEDARLALQVTKPRKMRRRSGKLYRSNINDRKVFNCFVIGKPCCGKSSLLEAFLGRSFSEEYSPTIKPRIAVNSLELKGGKQYYLILQELGEQ 508          
BLAST of DC900045 vs. ExPASy Swiss-Prot
Match: GEM1_ASPOR (Mitochondrial Rho GTPase 1 OS=Aspergillus oryzae GN=gem1 PE=3 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 7.474e-27
Identity = 70/190 (36.84%), Postives = 103/190 (54.21%), Query Frame = 2
Query:    8 KLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESP--WDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDP------AAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPE 553
            ++ P  S EL+ E   F   +F L D DNDG +  AEL  LF   P  P  W +  +  +      G++TL+G++++W++ T   P+ +L  L Y+G+           AAL+VTR R   ++  +  RNV    + GP  +GKSALL++FL R FS  Y PT   + AVN V+ PGG +  LIL E+ E
Sbjct:  294 EVPPYASAELSPEGYRFFVNLFLLSDKDNDGGLNDAELASLFAPTPGLPASWADGSFPSSTVRNEAGHVTLQGWLAQWSMTTFTSPKTTLEYLAYLGFESSDRSNPSTTAALKVTRPRKRRKRPGRVGRNVVLGHVLGPPGSGKSALLDAFLARGFSTTYHPTIQPRTAVNTVELPGGKQCYLILDELGE 483          
BLAST of DC900045 vs. ExPASy Swiss-Prot
Match: GEM1_NEUCR (Mitochondrial Rho GTPase 1 OS=Neurospora crassa GN=gem-1 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 9.761e-27
Identity = 67/183 (36.61%), Postives = 100/183 (54.64%), Query Frame = 2
Query:   26 SVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESP--WDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPA-----AALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPE 553
            S EL+     F   +F  +D DNDG +   EL  LF   P  P  W E  +         G++TL+G++++W++ T L+P+ +L  L Y+G+    A     AAL++T+ R   R+  + +RNV  C + G   AGKS+LL+ FL RPF   Y PT   + AVN V+  GG +  LIL+E+ E
Sbjct:  300 SAELSPAGYRFFMDLFLTFDKDNDGGLNDRELAALFAPTPGLPHSWAETSFPSTTVRNEAGHITLQGWLAQWSMTTFLEPKTTLEYLAYLGFETPNARETTTAALKITKPRKRRRRPGRVDRNVVLCYILGSSGAGKSSLLDVFLNRPFDTLYHPTIKPRQAVNSVELQGGKQCYLILEELGE 482          
BLAST of DC900045 vs. ExPASy Swiss-Prot
Match: GEM1_ASPFU (Mitochondrial Rho GTPase 1 OS=Aspergillus fumigatus GN=gem1 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 3.709e-26
Identity = 69/190 (36.32%), Postives = 102/190 (53.68%), Query Frame = 2
Query:    8 KLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESP--WDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDP------AAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPE 553
            ++ P  S EL+ E   F   +F L D DNDG +  AEL  LF   P  P  W +  +  +      G++TL+G++++W++ T   P+ +L  L Y+G+           AAL+VTR R   ++  +  RNV    + G   +GKSALL++FL R FS  Y PT   + AVN V+ PGG +  LIL E+ E
Sbjct:  294 EVPPFASAELSPEGYRFFVNLFLLSDKDNDGGLNDAELASLFAPTPGLPASWADGSFPSSTVRNEAGHVTLQGWLAQWSMTTFQSPKTTLEYLAYLGFESSDRSNPSTTAALKVTRPRKKRKRPGRVGRNVVLGHVLGAPGSGKSALLDAFLARGFSHTYRPTIQPRTAVNTVELPGGKQCYLILDELGE 483          
BLAST of DC900045 vs. ExPASy Swiss-Prot
Match: MIRO2_BOVIN (Mitochondrial Rho GTPase 2 OS=Bos taurus GN=RHOT2 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 6.327e-26
Identity = 72/194 (37.11%), Postives = 107/194 (55.15%), Query Frame = 2
Query:    2 PTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGY-----GGDPAAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQ--YAVNVVDQPGGNKKTLILQEIPEEGV 562
            P ++ P  S EL     +F++ +F  +D D DGA+ PAEL+ LF   P +PW   P+  +   T  G L L G++ +W L+T LD R SL +L Y+GY         A A+ VTR++ +D++K QT+RNV  C + G +  GKS+ L +FL        A   GE   YA++ V Q  G +K LIL E+  + +
Sbjct:  290 PLRVPPGCSAELNHRGYQFVQRMFEKHDQDRDGALSPAELQSLFSVFPAAPW--GPHLPSTVRTKAGRLPLHGYLCQWTLVTYLDVRRSLEHLGYLGYPTLCEQDSQAHAITVTREKRLDQEKGQTQRNVLLCKVVGARGVGKSSFLRAFLGHSLGHQDA---GEPSVYAIDTV-QVNGQEKYLILCEVAADSL 477          
The following BLAST results are available for this feature:
BLAST of DC900045 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
GEM1_CRYNE2.932e-3141.71Mitochondrial Rho GTPase 1 OS=Cryptococcus neoform... [more]
GEM1_CANGA4.234e-3040.21Mitochondrial Rho GTPase 1 OS=Candida glabrata GN=... [more]
GEM1_GIBZE3.034e-2837.70Mitochondrial Rho GTPase 1 OS=Gibberella zeae GN=G... [more]
MIRO2_CHICK8.828e-2840.21Mitochondrial Rho GTPase 2 OS=Gallus gallus GN=RHO... [more]
GEM1_ASHGO1.967e-2736.84Mitochondrial Rho GTPase 1 OS=Ashbya gossypii GN=G... [more]
GEM1_YEAST4.382e-2737.11Mitochondrial Rho GTPase 1 OS=Saccharomyces cerevi... [more]
GEM1_ASPOR7.474e-2736.84Mitochondrial Rho GTPase 1 OS=Aspergillus oryzae G... [more]
GEM1_NEUCR9.761e-2736.61Mitochondrial Rho GTPase 1 OS=Neurospora crassa GN... [more]
GEM1_ASPFU3.709e-2636.32Mitochondrial Rho GTPase 1 OS=Aspergillus fumigatu... [more]
MIRO2_BOVIN6.327e-2637.11Mitochondrial Rho GTPase 2 OS=Bos taurus GN=RHOT2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900045 VSS Citrus sinensis cDNA clone VS27Q52 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900045 ID=DC900045|Name=DC900045|organism=Citrus sinensis|type=EST|length=579bp
TCCAACTAAGCTCTCTCCTGATCAGAGTGTGGAACTGGCAAGTGAAGCTG
TGGAATTCCTACGTGGTATCTTCGGATTGTATGACATTGATAATGATGGA
GCAGTGAGGCCTGCGGAGCTTGAGGATCTATTTTTAACTGCACCAGAAAG
TCCGTGGGATGAAGCTCCATACAAGGATGCTGCAGAGACAACAGCACTGG
GCAATTTAACACTCAAAGGTTTCGTGTCTAAGTGGGCTCTAATGACTCTG
CTTGACCCGCGACACAGTTTGGCAAATTTGATATACGTTGGATACGGTGG
TGATCCTGCTGCAGCACTCCGTGTTACTAGGAAAAGATCAGTAGATCGTA
AGAAGCAACAAACTGAAAGAAATGTTTTCCGTTGTCTCCTTTTTGGTCCA
CAAAATGCTGGAAAGTCTGCACTGTTGAATTCATTCTTGGAAAGGCCATT
CTCAGAAAATTATGCCCCAACAACCGGTGAGCAATATGCGGTGAATGTGG
TTGACCAGCCTGGGGGAAATAAGAAGACTCTTATTCTGCAAGAAATACCA
GAAGAAGGAGTGAAAAAATCCTGTCCACC
back to top