DC900042

Overview
NameDC900042
Unique NameDC900042
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length384
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2157 contig Csv1_Contig2157:148..531. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900042 vs. ExPASy Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 1.046e-20
Identity = 50/86 (58.14%), Postives = 65/86 (75.58%), Query Frame = 1
Query:    7 PNSAREDPKEKHVMEIGQFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRLILVVKDGPS-TKKFEAVVWEKPWEHFKSLTSFKP 261
            P S   DP+   V+EIG+FAV+EYNK+S+S LKFE+V  GETQVVSGTNYRL +   DG   +K + A+VW+KPW  F++LTSF+P
Sbjct:   33 PISNVTDPQ---VVEIGEFAVSEYNKRSESGLKFETVVSGETQVVSGTNYRLKVAANDGDGVSKNYLAIVWDKPWMKFRNLTSFEP 115          
BLAST of DC900042 vs. ExPASy Swiss-Prot
Match: CYT1_MAIZE (Cystatin-1 OS=Zea mays GN=RAMDAZC7 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.484e-16
Identity = 38/74 (51.35%), Postives = 53/74 (71.62%), Query Frame = 1
Query:   43 VMEIGQFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRLILVVKDGPSTKKFEAVVWEKPWEHFKSLTSFKPM 264
            + E+ +FAV E+N+++ + L FE + K +TQVV+GT Y L + VKDG   K +EA VWEKPWE+FK L  FKP+
Sbjct:   56 LQELARFAVNEHNQKANALLGFEKLVKAKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKPWENFKQLQEFKPV 129          
BLAST of DC900042 vs. ExPASy Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 2.949e-15
Identity = 36/75 (48.00%), Postives = 53/75 (70.67%), Query Frame = 1
Query:   40 HVMEIGQFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRLILVVKDGPSTKKFEAVVWEKPWEHFKSLTSFKPM 264
            H++++ +FAVTE+NK++ S L+FE +   + QVV+GT Y   + VK+G + K +EA VWEKPW  FK L  FKP+
Sbjct:   60 HLVDLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPV 134          
BLAST of DC900042 vs. ExPASy Swiss-Prot
Match: CYT3_ARATH (Cysteine proteinase inhibitor 3 OS=Arabidopsis thaliana GN=CYS3 PE=2 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 5.562e-14
Identity = 35/80 (43.75%), Postives = 47/80 (58.75%), Query Frame = 1
Query:   19 REDPKEKHVMEIGQFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRLILVVKDGPSTKKFEAVVWEKPWEHFKSLTSFK 258
            R +     +  + +FA+ E+NKQ    L+F+ + K   QVV+GT Y L L  K+G  TK FEA VW KPW +FK L  FK
Sbjct:   42 RGNQNSGEIESLARFAIQEHNKQQNKILEFKKIVKAREQVVAGTMYHLTLEAKEGDQTKNFEAKVWVKPWMNFKQLQEFK 121          
BLAST of DC900042 vs. ExPASy Swiss-Prot
Match: CYTI_VIGUN (Cysteine proteinase inhibitor OS=Vigna unguiculata PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.789e-12
Identity = 34/69 (49.28%), Postives = 44/69 (63.77%), Query Frame = 1
Query:   52 IGQFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRLILVVKDGPSTKKFEAVVWEKPWEHFKSLTSFK 258
            + +FAV E+NK+  + L+F  V   + QVVSGT Y + L  KDG   K +EA VWEKPW +FK L  FK
Sbjct:   22 LARFAVEEHNKKQNALLEFGRVVSAQQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKPWLNFKELQEFK 90          
BLAST of DC900042 vs. ExPASy Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 1.789e-12
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 1
Query:   43 VMEIGQFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRLILVVKD-GPSTKKFEAVVWEKPWEHFKSLTSFKPM 264
            V+ + ++A+ E+NK+SK  L F  V +G TQVVSGT Y L +  KD G   K +EAVV EK W H KSL SFK +
Sbjct:   43 VVAVAKYAIEEHNKESKEKLVFVKVVEGTTQVVSGTKYDLKIAAKDGGGKIKNYEAVVVEKLWLHSKSLESFKAL 117          
BLAST of DC900042 vs. ExPASy Swiss-Prot
Match: CYT1_HORVU (Cysteine proteinase inhibitor OS=Hordeum vulgare GN=ICY PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.052e-12
Identity = 35/83 (42.17%), Postives = 53/83 (63.86%), Query Frame = 1
Query:   13 SAREDPKEKHVMEIGQFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRLILVVKDGPSTKKFEAVVWEKPWEHFKSLTSFKP 261
            + RE+  E   +E+ +FAV E+N ++ + L+FE + K   QVV+G  +   + VK+G + K +EA VWEK WE+FK L  FKP
Sbjct:   25 AGRENDLE--TIELARFAVAEHNAKANALLEFEKLVKVRQQVVAGCMHYFTIEVKEGGAKKLYEAKVWEKAWENFKQLQEFKP 105          
BLAST of DC900042 vs. ExPASy Swiss-Prot
Match: CYTA_HELAN (Cysteine proteinase inhibitor A OS=Helianthus annuus PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.978e-11
Identity = 32/72 (44.44%), Postives = 45/72 (62.50%), Query Frame = 1
Query:   49 EIGQFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRLILVVKDGPSTKKFEAVVWEKPWEHFKSLTSFKPM 264
            E+ +FAV E+NK+  + L+F  V   + QVV+G  Y + L   +G   K +EA VW KPWE+FK L  FKP+
Sbjct:    6 ELARFAVDEHNKKQNALLEFGKVVNTKEQVVAGKMYYITLEATNGGVKKTYEAKVWVKPWENFKELQEFKPV 77          
BLAST of DC900042 vs. ExPASy Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.978e-11
Identity = 34/80 (42.50%), Postives = 48/80 (60.00%), Query Frame = 1
Query:   25 DPKEKHVMEIGQFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRLILVVKD-GPSTKKFEAVVWEKPWEHFKSLTSFKP 261
            D  + H+ E+G +AV  +   S   L+F  V  GE QVVSG NYRL++   D   +T  + AVV+E+ W + + LTSFKP
Sbjct:   40 DVGDPHIQELGGWAVERHASLSSDGLRFRRVTSGEQQVVSGMNYRLVVSASDPAGATASYVAVVYEQSWTNTRQLTSFKP 119          
BLAST of DC900042 vs. ExPASy Swiss-Prot
Match: CYT6_ARATH (Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana GN=CYS6 PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 4.407e-11
Identity = 32/73 (43.84%), Postives = 45/73 (61.64%), Query Frame = 1
Query:   43 VMEIGQFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRLILVVKDGPSTKKFEAVVWEKPWEHFKSLTSFKP 261
            V  + +FAV E+NK+  + L+F  V K + QVV+GT + L L + +    K +EA VW KPW +FK L  FKP
Sbjct:   52 VESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKVWVKPWLNFKELQEFKP 124          
The following BLAST results are available for this feature:
BLAST of DC900042 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
CYT5_ARATH1.046e-2058.14Cysteine proteinase inhibitor 5 OS=Arabidopsis tha... [more]
CYT1_MAIZE3.484e-1651.35Cystatin-1 OS=Zea mays GN=RAMDAZC7 PE=2 SV=1[more]
CYT1_ORYSJ2.949e-1548.00Cysteine proteinase inhibitor 1 OS=Oryza sativa su... [more]
CYT3_ARATH5.562e-1443.75Cysteine proteinase inhibitor 3 OS=Arabidopsis tha... [more]
CYTI_VIGUN1.789e-1249.28Cysteine proteinase inhibitor OS=Vigna unguiculata... [more]
CYT4_ARATH1.789e-1250.67Cysteine proteinase inhibitor 4 OS=Arabidopsis tha... [more]
CYT1_HORVU3.052e-1242.17Cysteine proteinase inhibitor OS=Hordeum vulgare G... [more]
CYTA_HELAN1.978e-1144.44Cysteine proteinase inhibitor A OS=Helianthus annu... [more]
CYT8_ORYSJ1.978e-1142.50Cysteine proteinase inhibitor 8 OS=Oryza sativa su... [more]
CYT6_ARATH4.407e-1143.84Cysteine proteinase inhibitor 6 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900042 VSS Citrus sinensis cDNA clone VS27Q49 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900042 ID=DC900042|Name=DC900042|organism=Citrus sinensis|type=EST|length=384bp
CTCGTGCCGAATTCGGCACGAGAGGACCCCAAGGAGAAGCACGTGATGGA
GATCGGACAGTTCGCGGTGACGGAGTACAACAAACAGTCAAAGAGCGCGT
TGAAGTTCGAGAGCGTGGAGAAGGGCGAGACTCAGGTGGTTTCCGGCACC
AATTACCGGCTGATCTTGGTCGTCAAGGACGGACCTTCGACCAAGAAATT
TGAAGCTGTCGTTTGGGAGAAGCCATGGGAGCATTTCAAGAGTCTCACCT
CGTTTAAGCCTATGGTTAAATAGGGTGTTTAACAAATAACAATGCATGTA
ATCTCAGATTGATAATTATTAAGGTTTTCGTTATGTGAGTGATGATATTA
TTATATTGTTTATGAATGTCAAAGGTGAGTCTTT
back to top