DC900039

Overview
NameDC900039
Unique NameDC900039
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length772
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig466 contig Csv1_Contig466:742..1513. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900039 vs. ExPASy Swiss-Prot
Match: CNOT3_MOUSE (CCR4-NOT transcription complex subunit 3 OS=Mus musculus GN=Cnot3 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.348e-42
Identity = 83/153 (54.25%), Postives = 100/153 (65.36%), Query Frame = 3
Query:  183 DQMYNMQMLESAFYKLPQPKDSERARSYIPRHPAVTPPSYPQVQAPIVSNPAFWERLSLDSYGTDTLFFAFYYQQNTYQQYLAAKELKKQSWRYHRKYNTWFQRHEEPKVANDEFEQGTYVYFDFHIANDDLQHGWCQRIKTEFTFEYNYLED 641
            +Q+Y   M E+A++ +P P DSER R Y+PR+P  TPP + Q+  P      F++RLS     T+TLFF FYY + T  QYLAAK LKKQSWR+H KY  WFQRHEEPK   DEFEQGTY+YFD+          W QR K  FTFEY YLED
Sbjct:  608 EQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLS-----TETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDY--------EKWGQRKKEGFTFEYRYLED 747          
BLAST of DC900039 vs. ExPASy Swiss-Prot
Match: CNOT3_HUMAN (CCR4-NOT transcription complex subunit 3 OS=Homo sapiens GN=CNOT3 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.348e-42
Identity = 83/153 (54.25%), Postives = 100/153 (65.36%), Query Frame = 3
Query:  183 DQMYNMQMLESAFYKLPQPKDSERARSYIPRHPAVTPPSYPQVQAPIVSNPAFWERLSLDSYGTDTLFFAFYYQQNTYQQYLAAKELKKQSWRYHRKYNTWFQRHEEPKVANDEFEQGTYVYFDFHIANDDLQHGWCQRIKTEFTFEYNYLED 641
            +Q+Y   M E+A++ +P P DSER R Y+PR+P  TPP + Q+  P      F++RLS     T+TLFF FYY + T  QYLAAK LKKQSWR+H KY  WFQRHEEPK   DEFEQGTY+YFD+          W QR K  FTFEY YLED
Sbjct:  610 EQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLS-----TETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDY--------EKWGQRKKEGFTFEYRYLED 749          
BLAST of DC900039 vs. ExPASy Swiss-Prot
Match: NOT3_SCHPO (General negative regulator of transcription subunit 3 OS=Schizosaccharomyces pombe GN=not3 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.435e-33
Identity = 67/139 (48.20%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  228 LPQPKDSERARSYIPRHPAVTPPSYPQVQAPIVSNPAFWERLSLDSYGTDTLFFAFYYQQNTYQQYLAAKELKKQSWRYHRKYNTWFQRHEEPKVANDEFEQGTYVYFDFHIANDDLQHGWCQRIKTEFTFEYNYLEDE 644
            +P   D+ + + YIP+ P   P  YPQ   P+  +    E +       DTLF+ FYY+  TYQQY+A +ELKKQSWR+H+KY TWFQRHEEPK+  DEFE G+Y YFDF       +  W QR K +F F Y YLED+
Sbjct:  499 VPDATDAAKPQYYIPKDPYPVPHYYPQQPLPLFDSSEMTELVD-----PDTLFYMFYYRPGTYQQYIAGQELKKQSWRFHKKYTTWFQRHEEPKMITDEFESGSYRYFDF-------EGDWVQRKKADFRFTYQYLEDD 625          
The following BLAST results are available for this feature:
BLAST of DC900039 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CNOT3_MOUSE8.348e-4254.25CCR4-NOT transcription complex subunit 3 OS=Mus mu... [more]
CNOT3_HUMAN8.348e-4254.25CCR4-NOT transcription complex subunit 3 OS=Homo s... [more]
NOT3_SCHPO2.435e-3348.20General negative regulator of transcription subuni... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900039 VSS Citrus sinensis cDNA clone VS27Q47 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900039 ID=DC900039|Name=DC900039|organism=Citrus sinensis|type=EST|length=772bp
TATCTGCCTCTTTGACAGAGCCTGCTCAAGTTGTCAGGGACACCGATCTT
TCTCCTGGACAACCCTTACAATCCAGTCAGCCTTCCGGTGGCCTCGGTGT
TATTGGCCGGCGAAGTGTTTCTGATCTTGGTGCCATTGGTGATAGCCTGA
GTGGAGCAACTGTGAGTTCCGGCGGCATGCATGATCAGATGTACAATATG
CAGATGCTTGAATCTGCATTTTATAAACTTCCACAGCCAAAGGATTCAGA
ACGCGCCAGGAGCTACATTCCAAGACACCCTGCTGTAACACCTCCTAGCT
ATCCTCAAGTTCAGGCACCCATTGTGAGTAACCCTGCTTTCTGGGAACGA
TTGTCTCTGGACAGCTACGGTACCGATACACTGTTCTTTGCATTTTACTA
CCAGCAGAATACTTACCAGCAATATTTGGCCGCTAAAGAGCTAAAGAAGC
AATCTTGGAGATACCACAGAAAATACAACACATGGTTCCAACGGCATGAG
GAGCCTAAAGTTGCCAATGATGAATTCGAACAGGGAACTTATGTGTACTT
TGACTTTCATATCGCCAATGATGATCTCCAACATGGATGGTGTCAAAGGA
TCAAGACCGAGTTCACTTTTGAGTATAACTACCTTGAAGATGAGCTTATT
GTATAGCGACTGAGTAGAAGATGCTATAAGATTGACCATGGCCAGCAATA
GAATTTGCAGCTGTACAATTTGTATTGATTACACTGTTCCATAATGGTCT
ATGAATTGTTAGGCTGTGTTTC
back to top