DC900036

Overview
NameDC900036
Unique NameDC900036
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length508
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900036_ssr1 microsatellite DC900036_ssr1:1..20. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6351 contig Csv1_Contig6351:103..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SMT3_ARATH (Ubiquitin-like protein SMT3 OS=Arabidopsis thaliana GN=SMT3 PE=1 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 2.758e-42
Identity = 82/89 (92.13%), Postives = 85/89 (95.51%), Query Frame = 1
Query:   61 QEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            QEEDKKP D  AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV++NSIAFLFDGRRLR EQTPDEL+MEDGDEIDAMLHQTGG
Sbjct:    5 QEEDKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNSIAFLFDGRRLRAEQTPDELDMEDGDEIDAMLHQTGG 93          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SMT3_ORYSJ (Ubiquitin-like protein SMT3 OS=Oryza sativa subsp. japonica GN=SMT3 PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 2.581e-40
Identity = 82/93 (88.17%), Postives = 85/93 (91.40%), Query Frame = 1
Query:   64 EEDKKP---NDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGML 333
            EEDKKP       AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV++N+IAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG L
Sbjct:    6 EEDKKPAGGEGGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNAIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGCL 98          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: PMT3_SCHPO (Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe GN=pmt3 PE=1 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 5.777e-24
Identity = 52/93 (55.91%), Postives = 68/93 (73.12%), Query Frame = 1
Query:   49 TNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            T    ++D KP+ +  HINLKV GQD NEVFF+IK++T+  KLM  YC RQ   +NS+ FL DG R+R +QTP EL+MEDGD+I+A+L Q GG
Sbjct:   21 TGDTSQQDVKPSTE--HINLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQLGG 111          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO3_XENTR (Small ubiquitin-related modifier 3 OS=Xenopus tropicalis GN=sumo3 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 8.632e-20
Identity = 50/91 (54.95%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  ND   HINLKV GQDG+ V F+IKR T L KLM AYCDRQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTEND---HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCDRQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 93          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO3_XENLA (Small ubiquitin-related modifier 3 OS=Xenopus laevis GN=sumo3 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 8.632e-20
Identity = 50/91 (54.95%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  ND   HINLKV GQDG+ V F+IKR T L KLM AYCDRQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTEND---HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCDRQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 93          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO3_CHICK (Small ubiquitin-related modifier 3 OS=Gallus gallus GN=SUMO3 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.923e-19
Identity = 49/91 (53.85%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  ND   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTEND---HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINEADTPAQLEMEDEDTIDVFQQQTGGL 93          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO3_HUMAN (Small ubiquitin-related modifier 3 OS=Homo sapiens GN=SUMO3 PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 2.511e-19
Identity = 49/91 (53.85%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  ND   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTEND---HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 93          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO3_RAT (Small ubiquitin-related modifier 3 OS=Rattus norvegicus GN=Sumo3 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.280e-19
Identity = 49/90 (54.44%), Postives = 58/90 (64.44%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            P+E  K  ND   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    6 PKEGVKTEND---HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO3_MOUSE (Small ubiquitin-related modifier 3 OS=Mus musculus GN=Sumo3 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.280e-19
Identity = 49/90 (54.44%), Postives = 58/90 (64.44%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            P+E  K  ND   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    6 PKEGVKTEND---HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO3_DANRE (Small ubiquitin-related modifier 3 OS=Danio rerio GN=sumo3 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.280e-19
Identity = 49/90 (54.44%), Postives = 58/90 (64.44%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            P+E  K  ND   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    6 PREGVKTEND---HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92          
The following BLAST results are available for this feature:
BLAST of DC900036 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
SMT3_ARATH2.758e-4292.13Ubiquitin-like protein SMT3 OS=Arabidopsis thalian... [more]
SMT3_ORYSJ2.581e-4088.17Ubiquitin-like protein SMT3 OS=Oryza sativa subsp.... [more]
PMT3_SCHPO5.777e-2455.91Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharo... [more]
SUMO3_XENTR8.632e-2054.95Small ubiquitin-related modifier 3 OS=Xenopus trop... [more]
SUMO3_XENLA8.632e-2054.95Small ubiquitin-related modifier 3 OS=Xenopus laev... [more]
SUMO3_CHICK1.923e-1953.85Small ubiquitin-related modifier 3 OS=Gallus gallu... [more]
SUMO3_HUMAN2.511e-1953.85Small ubiquitin-related modifier 3 OS=Homo sapiens... [more]
SUMO3_RAT3.280e-1954.44Small ubiquitin-related modifier 3 OS=Rattus norve... [more]
SUMO3_MOUSE3.280e-1954.44Small ubiquitin-related modifier 3 OS=Mus musculus... [more]
SUMO3_DANRE3.280e-1954.44Small ubiquitin-related modifier 3 OS=Danio rerio ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900036 VSS Citrus sinensis cDNA clone VS27Q44 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900036 ID=DC900036|Name=DC900036|organism=Citrus sinensis|type=EST|length=508bp
GAGAGAGAGAGAGAGAGAGACGAAGCAGAAGAGAGAATGTCAGGCGTCAC
GAACACTCCGCAAGAGGAAGATAAGAAGCCCAACGATCAATCGGCTCACA
TCAATCTCAAAGTCAAGGGCCAGGATGGGAATGAGGTTTTCTTCAGGATC
AAACGAAGCACCCAACTAAAGAAGCTTATGAATGCATACTGTGATAGACA
ATCTGTGGAGCTGAACTCAATTGCCTTCTTGTTTGATGGCCGCCGTCTTC
GAGGAGAGCAAACCCCTGATGAGCTGGAAATGGAAGATGGTGATGAGATT
GATGCCATGCTGCACCAAACCGGAGGAATGCTGATGTTCTAATTATGTAA
TGCTCGTTTGAGAGCTTATTAGTAGTATTAATGTAAAACTATTTATGGAT
GGATGTAAGTTATGCAGAGGCTCAAGATTGTGTATTTGTGATCTACACCA
TTATGTTTGGATTACCTAAGTATGTAGCTCTTTCTTCAAGAGCCCTGATC
GTTGCGGT
back to top