DC900035

Overview
NameDC900035
Unique NameDC900035
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length436
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTPA_RICCO (Non-specific lipid-transfer protein A OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.460e-17
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 3
Query:    3 GEAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            G A PS +CC GV+ LK   PT+ADR+AAC+CIK AA R+  IK D A  LPK+CGVDI +PI+   +C  I+
Sbjct:   20 GVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFPTIKQDAASSLPKKCGVDINIPISKTTNCQAIN 92          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP1_ORYSJ (Non-specific lipid-transfer protein 1 OS=Oryza sativa subsp. japonica GN=LTP PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.107e-14
Identity = 34/73 (46.58%), Postives = 46/73 (63.01%), Query Frame = 3
Query:    3 GEAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            G A PS ACC+GV  LK    TTADR+ AC C+K+AA   +G+    A  +P +CGV +   I+  IDCS++S
Sbjct:   44 GGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS 116          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP1_ORYSI (Non-specific lipid-transfer protein 1 OS=Oryza sativa subsp. indica GN=LTP PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.107e-14
Identity = 34/73 (46.58%), Postives = 46/73 (63.01%), Query Frame = 3
Query:    3 GEAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            G A PS ACC+GV  LK    TTADR+ AC C+K+AA   +G+    A  +P +CGV +   I+  IDCS++S
Sbjct:   44 GGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS 116          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTPB_ARATH (Non-specific lipid-transfer protein 11 OS=Arabidopsis thaliana GN=LTP11 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.977e-14
Identity = 34/69 (49.28%), Postives = 43/69 (62.32%), Query Frame = 3
Query:   15 PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            PS  CC G+  LK   P  ADRQ AC C+K  A    GI  D A+QLP +CGV+IGVP +  +DC+ I+
Sbjct:   51 PSPMCCNGLNSLKAAAPEKADRQVACNCLKSVANTIPGINDDFAKQLPAKCGVNIGVPFSKTVDCNSIN 119          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP3_ORYSJ (Non-specific lipid-transfer protein 3 OS=Oryza sativa subsp. japonica GN=LTP110-A PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.977e-14
Identity = 29/72 (40.28%), Postives = 47/72 (65.28%), Query Frame = 3
Query:    6 EAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            E+ PS +CC+GV  L     ++ADR+ AC C+K+ A+ +R + +  A  +P +CGV +  PI+  +DCSKI+
Sbjct:   50 ESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKIN 121          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP3_ORYSI (Non-specific lipid-transfer protein 3 OS=Oryza sativa subsp. indica GN=LTP110-A PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.977e-14
Identity = 29/72 (40.28%), Postives = 47/72 (65.28%), Query Frame = 3
Query:    6 EAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            E+ PS +CC+GV  L     ++ADR+ AC C+K+ A+ +R + +  A  +P +CGV +  PI+  +DCSKI+
Sbjct:   50 ESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKIN 121          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP2_SORBI (Non-specific lipid-transfer protein 2 OS=Sorghum bicolor GN=LTP2 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.777e-13
Identity = 33/69 (47.83%), Postives = 44/69 (63.77%), Query Frame = 3
Query:   15 PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            PS  CC+GV  L     TTADR+AAC C+K+AA   RG+ + KA  +P +CGV I   I+   DCS++S
Sbjct:   54 PSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPSKCGVSIPYTISTSTDCSRVS 122          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP3_HORVU (Non-specific lipid-transfer protein 3 OS=Hordeum vulgare GN=LTP3 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.321e-13
Identity = 32/70 (45.71%), Postives = 46/70 (65.71%), Query Frame = 3
Query:    9 AKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            AKP  ACC+GV+ L     +TAD+QAAC+C+K  AT  +GI + K   +P +CGV +  PI+   DC+K+
Sbjct:   48 AKPPVACCSGVKRLAGAAQSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGVSVPFPISMSTDCNKV 117          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP2_ORYSI (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica GN=LTP2-A PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.753e-13
Identity = 32/73 (43.84%), Postives = 43/73 (58.90%), Query Frame = 3
Query:    3 GEAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            G + PS ACC+GV  L     TTADR+ AC C+K+ A    G+    A  +P +CGV I   I+P IDCS ++
Sbjct:   46 GGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN 118          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLT2B_ORYSJ (Non-specific lipid-transfer protein 2B OS=Oryza sativa subsp. japonica GN=LTP2-B PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.753e-13
Identity = 32/73 (43.84%), Postives = 43/73 (58.90%), Query Frame = 3
Query:    3 GEAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            G + PS ACC+GV  L     TTADR+ AC C+K+ A    G+    A  +P +CGV I   I+P IDCS ++
Sbjct:   45 GGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN 117          
The following BLAST results are available for this feature:
BLAST of DC900035 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 29
Match NameE-valueIdentityDescription
NLTPA_RICCO3.460e-1754.79Non-specific lipid-transfer protein A OS=Ricinus c... [more]
NLTP1_ORYSJ6.107e-1446.58Non-specific lipid-transfer protein 1 OS=Oryza sat... [more]
NLTP1_ORYSI6.107e-1446.58Non-specific lipid-transfer protein 1 OS=Oryza sat... [more]
NLTPB_ARATH7.977e-1449.28Non-specific lipid-transfer protein 11 OS=Arabidop... [more]
NLTP3_ORYSJ7.977e-1440.28Non-specific lipid-transfer protein 3 OS=Oryza sat... [more]
NLTP3_ORYSI7.977e-1440.28Non-specific lipid-transfer protein 3 OS=Oryza sat... [more]
NLTP2_SORBI1.777e-1347.83Non-specific lipid-transfer protein 2 OS=Sorghum b... [more]
NLTP3_HORVU2.321e-1345.71Non-specific lipid-transfer protein 3 OS=Hordeum v... [more]
NLTP2_ORYSI6.753e-1343.84Non-specific lipid-transfer protein 2 OS=Oryza sat... [more]
NLT2B_ORYSJ6.753e-1343.84Non-specific lipid-transfer protein 2B OS=Oryza sa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900035 VSS Citrus sinensis cDNA clone VS27Q43 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900035 ID=DC900035|Name=DC900035|organism=Citrus sinensis|type=EST|length=436bp
CCGGGGAAGCCAAGCCATCTCGGGCATGCTGCACTGGTGTCGAGTATCTG
AAAGACAACACTCCAACAACTGCAGACAGGCAAGCTGCTTGTAAATGCAT
CAAAGATGCGGCAACTCGCTATCGCGGCATCAAGCTGGACAAAGCTCGTC
AACTCCCCAAAGAATGTGGCGTCGACATTGGCGTTCCCATCACCCCCGAT
ATCGACTGTAGCAAAATTTCTTAGAACCCCCCACGGAGGCTTTGAGCTTG
TGCGTTGAATAAACTTCTCTGCCTGGAGAAAACACAGCACAATTAGTACA
CATGATCTAATTATGCTTGTTAATTTATGCTGCTTGTTATGGTTCTTGCT
GAAGAACTTTTGTATCGGGATACTTATAGTGCATGGTGTTTTGGCACATA
ATTAGCGTTAATAAAACTACAGTTATTACCTCTACC
back to top