DC900034

Overview
NameDC900034
Unique NameDC900034
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length481
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5632 contig Csv1_Contig5632:1..481. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB_ORYSJ (Probable voltage-gated potassium channel subunit beta OS=Oryza sativa subsp. japonica GN=KOB1 PE=1 SV=2)

HSP 1 Score: 164.081 bits (414), Expect = 2.933e-40
Identity = 84/99 (84.85%), Postives = 88/99 (88.89%), Query Frame = -1
Query:  173 FAWKNYKNLANRSLVDDVLNKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 469
            FA +NYKNLANRSLVDD L KVN LKPIA ELGV LAQLAIAWCASNPNVSSVITGATKE+QI ENMKA+DVIPLLTP V+DKIEA V SKPKR ESYR
Sbjct:  230 FALENYKNLANRSLVDDTLRKVNGLKPIASELGVSLAQLAIAWCASNPNVSSVITGATKENQIVENMKALDVIPLLTPEVVDKIEAVVQSKPKRTESYR 328          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB2_RAT (Voltage-gated potassium channel subunit beta-2 OS=Rattus norvegicus GN=Kcnab2 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 39/100 (39.00%), Postives = 58/100 (58.00%), Query Frame = -1
Query:  173 GFAWKNYKNLANRSLVDDVLNKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 472
            G+ W   K L+          K+  L+ IA+ LG  L QLAIAWC  N  VSSV+ GA+   Q+ EN+ AI V+P L+ S++ +I++ + +KP   + YR
Sbjct:  269 GYQWLKDKILSEEGRRQQA--KLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYSKKDYR 366          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB2_MOUSE (Voltage-gated potassium channel subunit beta-2 OS=Mus musculus GN=Kcnab2 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 39/100 (39.00%), Postives = 58/100 (58.00%), Query Frame = -1
Query:  173 GFAWKNYKNLANRSLVDDVLNKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 472
            G+ W   K L+          K+  L+ IA+ LG  L QLAIAWC  N  VSSV+ GA+   Q+ EN+ AI V+P L+ S++ +I++ + +KP   + YR
Sbjct:  269 GYQWLKDKILSEEGRRQQA--KLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYSKKDYR 366          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB2_HUMAN (Voltage-gated potassium channel subunit beta-2 OS=Homo sapiens GN=KCNAB2 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 39/100 (39.00%), Postives = 58/100 (58.00%), Query Frame = -1
Query:  173 GFAWKNYKNLANRSLVDDVLNKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 472
            G+ W   K L+          K+  L+ IA+ LG  L QLAIAWC  N  VSSV+ GA+   Q+ EN+ AI V+P L+ S++ +I++ + +KP   + YR
Sbjct:  269 GYQWLKDKILSEEGRRQQA--KLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSKKDYR 366          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB2_BOVIN (Voltage-gated potassium channel subunit beta-2 OS=Bos taurus GN=KCNAB2 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 39/100 (39.00%), Postives = 58/100 (58.00%), Query Frame = -1
Query:  173 GFAWKNYKNLANRSLVDDVLNKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 472
            G+ W   K L+          K+  L+ IA+ LG  L QLAIAWC  N  VSSV+ GA+   Q+ EN+ AI V+P L+ S++ +I++ + +KP   + YR
Sbjct:  269 GYQWLKDKILSEEGRRQQA--KLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASSADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSKKDYR 366          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB1_RAT (Voltage-gated potassium channel subunit beta-1 OS=Rattus norvegicus GN=Kcnab1 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = -1
Query:  173 NKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 412
            NK+  L PIA+ LG  L QLA+AWC  N  VSSV+ G++   Q+ EN+ AI V+P +T  V+++I+  + +KP   + YR
Sbjct:  321 NKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYR 400          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB1_RABIT (Voltage-gated potassium channel subunit beta-1 OS=Oryctolagus cuniculus GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = -1
Query:  173 NKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 412
            NK+  L PIA+ LG  L QLA+AWC  N  VSSV+ G++   Q+ EN+ AI V+P +T  V+++I+  + +KP   + YR
Sbjct:  339 NKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYR 418          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB1_MUSPU (Voltage-gated potassium channel subunit beta-1 OS=Mustela putorius GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = -1
Query:  173 NKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 412
            NK+  L PIA+ LG  L QLA+AWC  N  VSSV+ G++   Q+ EN+ AI V+P +T  V+++I+  + +KP   + YR
Sbjct:  328 NKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYR 407          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB1_MOUSE (Voltage-gated potassium channel subunit beta-1 OS=Mus musculus GN=Kcnab1 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = -1
Query:  173 NKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 412
            NK+  L PIA+ LG  L QLA+AWC  N  VSSV+ G++   Q+ EN+ AI V+P +T  V+++I+  + +KP   + YR
Sbjct:  321 NKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYR 400          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB1_HUMAN (Voltage-gated potassium channel subunit beta-1 OS=Homo sapiens GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = -1
Query:  173 NKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 412
            NK+  L PIA+ LG  L QLA+AWC  N  VSSV+ G++   Q+ EN+ AI V+P +T  V+++I+  + +KP   + YR
Sbjct:  339 NKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYR 418          
The following BLAST results are available for this feature:
BLAST of DC900034 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
KCAB_ORYSJ2.933e-4084.85Probable voltage-gated potassium channel subunit b... [more]
KCAB2_RAT6.810e-1339.00Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB2_MOUSE6.810e-1339.00Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB2_HUMAN6.810e-1339.00Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB2_BOVIN6.810e-1339.00Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB1_RAT6.810e-1343.75Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_RABIT6.810e-1343.75Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_MUSPU6.810e-1343.75Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_MOUSE6.810e-1343.75Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_HUMAN6.810e-1343.75Voltage-gated potassium channel subunit beta-1 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900034 VSS Citrus sinensis cDNA clone VS27Q42 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900034 ID=DC900034|Name=DC900034|organism=Citrus sinensis|type=EST|length=481bp
TCATTTTCTTTTACAAGAAAATATATCATATCTGAGAGTCTCTGAAGTAC
AGAGCTAAGAAACAATAACTAAAACATCAGACAAGCATAGTAACAACATG
AATACACTGAAGCAGCTAGGTATGTCGCACGCAGCAGAAGATGGAAATGA
GCTAATAAATAATCTCCGCCTACCGATACGACTCCGGACGCTTTGGCTTG
CTTAGAACAGCAGCCTCAATCTTGTCCATCACTGACGGAGTCAGCAGTGG
AATGACATCAATGGCTTTCATGTTCTCTTGAATCTGGGATTCCTTTGTGG
CACCAGTTATAACTGAAGATACATTAGGATTTGAAGCACACCATGCAATT
GCAAGTTGAGCTAAAGGCACGCCTAGTTCATCTGCAATTGGCTTCAGTCG
ATTAACTTTATTCAGCACATCATCGACCAGTGATCGGTTAGCAAGATTCT
TGTAATTTTTCCAAGCAAACCCGACTGTCAG
back to top