DC900032

Overview
NameDC900032
Unique NameDC900032
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length868
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10323 contig Csv1_Contig10323:43..909. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900032 vs. ExPASy Swiss-Prot
Match: PRF1_SOLLC (36.4 kDa proline-rich protein OS=Solanum lycopersicum GN=TPRP-F1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.146e-11
Identity = 35/81 (43.21%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  372 IDTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLQGLVELEAAVXXXXXXXXXXXXXXXXXXXXXXXXV-TCGKTPPAGFTC 611
            ID LKLGACVD+LGGL+HIG+G      CCP+L GLV+L+AA+                        +  CGK PP  F C
Sbjct:  263 IDALKLGACVDVLGGLIHIGIGGSAKQTCCPLLGGLVDLDAAICLCTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKC 343          
The following BLAST results are available for this feature:
BLAST of DC900032 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PRF1_SOLLC3.146e-1143.2136.4 kDa proline-rich protein OS=Solanum lycopersi... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900032 VSS Citrus sinensis cDNA clone VS27Q40 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900032 ID=DC900032|Name=DC900032|organism=Citrus sinensis|type=EST|length=868bp
GAGAGATTTAAAATAAAGAAAAAAAAAAAAAAATGGACTCCTCCAAACTC
TCAGCTCTCCTCATCATTTGCATGCTTTTCATCTCCACAGCCACTCCCAT
TCTTGGCTGTGGCACGTGTGGCAAGCCGCACCCGAAGCACAGGAAACCTA
GGCAGCCTAGACCCATCAGTCTTCCTCCCATTGTCAAACCCCCAGTTCCC
TTGCCACCAGTCACTCTCCCTCCGGTGACCGTCCCGCCGATCAAGCCACC
AGTCGACCTCCCCACTCTCCCACCAGTTACACTGCCTCCAGTTCTCCCTA
ACCCACCAAGTGCTAGGAAGCCATGCCCATGTTCATACACACCACCTCCA
CCAGCTGCTGCCACATGCCCCATTGACACCCTCAAATTGGGTGCTTGTGT
GGACCTTCTTGGTGGGTTGGTTCACATTGGTCTTGGTGACCCAGTTGTTA
ACCAATGCTGCCCAGTTCTACAAGGACTTGTTGAGTTAGAAGCTGCTGTC
TGCTTGTGCACTACTCTCAAGCTCAAGCTGCTTAATCTTAACATCTATCT
TCCACTTGCTCTTCAGCTTCTTGTCACTTGCGGAAAGACACCACCCGCTG
GTTTCACTTGCACTCTTTAGATCTAAGGTTGGTAGATTGATGATGGATAC
TGAAGGAAGAAATCGACATGAAAGGATGTCGAGACTTATTTGTTTGTTTC
TTTTTCTCTCTCCCCCACTCTCTCTGTCTTTCTCTCATTGTTGGGATTGT
AATGTTTGGTCACATTTAATTGNACACCCATTTGTTTTTATATGATTTGT
CGCATTGTATGTGTGTTTTCAATGTCCTTGACAAGGCAGCAATTATTTGA
TTTTCCTACCTCATTTTC
back to top