DC900026

Overview
NameDC900026
Unique NameDC900026
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length481
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5158 contig Csv1_Contig5158:352..833. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900026 vs. ExPASy Swiss-Prot
Match: BRI1_ARATH (Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 6.562e-40
Identity = 87/118 (73.73%), Postives = 97/118 (82.20%), Query Frame = 3
Query:    6 LLELLTEKGHRFSR-FR*Q*PSGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTI-ATDEGGFGTVEMVEMSIQEAPE 353
            LLELLT K    S  F      GWVKQHAKL+ISDVFDPELMKEDP +EIELLQHL VA ACLDDR WRRPTM+QVMAMFKEIQAGSG+DSQSTI + ++GGF T+EMV+MSI+E PE
Sbjct: 1076 LLELLTGKRPTDSPDFGDNNLVGWVKQHAKLRISDVFDPELMKEDPALEIELLQHLKVAVACLDDRAWRRPTMVQVMAMFKEIQAGSGIDSQSTIRSIEDGGFSTIEMVDMSIKEVPE 1193          
BLAST of DC900026 vs. ExPASy Swiss-Prot
Match: BRI1_SOLPE (Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 4.263e-31
Identity = 80/124 (64.52%), Postives = 89/124 (71.77%), Query Frame = 3
Query:    6 LLELLTEKGHRFSR-FR*Q*PSGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGF----GTVEM-VEMSIQEAPELS 359
            LLELLT K    S  F      GWVK HAK KI+DVFD EL+KED +IEIELLQHL VA ACLDDR W+RPTMIQVMAMFKEIQAGSG+DS STI  D+  F    G +EM +  SI+E  ELS
Sbjct: 1081 LLELLTGKQPTDSADFGDNNLVGWVKLHAKGKITDVFDRELLKEDASIEIELLQHLKVACACLDDRHWKRPTMIQVMAMFKEIQAGSGMDSTSTIGADDVNFSGVEGGIEMGINGSIKEGNELS 1204          
BLAST of DC900026 vs. ExPASy Swiss-Prot
Match: BRI1_SOLLC (Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 4.263e-31
Identity = 80/124 (64.52%), Postives = 89/124 (71.77%), Query Frame = 3
Query:    6 LLELLTEKGHRFSR-FR*Q*PSGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGF----GTVEM-VEMSIQEAPELS 359
            LLELLT K    S  F      GWVK HAK KI+DVFD EL+KED +IEIELLQHL VA ACLDDR W+RPTMIQVMAMFKEIQAGSG+DS STI  D+  F    G +EM +  SI+E  ELS
Sbjct: 1081 LLELLTGKQPTDSADFGDNNLVGWVKLHAKGKITDVFDRELLKEDASIEIELLQHLKVACACLDDRHWKRPTMIQVMAMFKEIQAGSGMDSTSTIGADDVNFSGVEGGIEMGINGSIKEGNELS 1204          
BLAST of DC900026 vs. ExPASy Swiss-Prot
Match: BRL1_ARATH (Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 5.236e-13
Identity = 40/95 (42.11%), Postives = 62/95 (65.26%), Query Frame = 3
Query:   69 GWVKQ-HAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFGTVEMVEMSIQEAP 350
            GW KQ + + + +++ DPEL+  D + ++EL  +L +AS CLDDRP++RPTMIQ+MAMFKE++A    D++   + DE       +VE S  + P
Sbjct: 1077 GWAKQLYREKRGAEILDPELVT-DKSGDVELFHYLKIASQCLDDRPFKRPTMIQLMAMFKEMKA----DTEEDESLDEFSLKETPLVEESRDKEP 1166          
BLAST of DC900026 vs. ExPASy Swiss-Prot
Match: BRL3_ARATH (Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.290e-11
Identity = 33/62 (53.23%), Postives = 48/62 (77.42%), Query Frame = 3
Query:   69 GWVKQ-HAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEI 251
            GW KQ + + + +++ DPEL+  D + ++ELL +L +AS CLDDRP++RPTMIQVM MFKE+
Sbjct: 1075 GWAKQLYREKRGAEILDPELVT-DKSGDVELLHYLKIASQCLDDRPFKRPTMIQVMTMFKEL 1135          
The following BLAST results are available for this feature:
BLAST of DC900026 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
BRI1_ARATH6.562e-4073.73Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidops... [more]
BRI1_SOLPE4.263e-3164.52Systemin receptor SR160 OS=Solanum peruvianum PE=1... [more]
BRI1_SOLLC4.263e-3164.52Brassinosteroid LRR receptor kinase OS=Solanum lyc... [more]
BRL1_ARATH5.236e-1342.11Serine/threonine-protein kinase BRI1-like 1 OS=Ara... [more]
BRL3_ARATH1.290e-1153.23Receptor-like protein kinase BRI1-like 3 OS=Arabid... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900026 VSS Citrus sinensis cDNA clone VS27Q33 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900026 ID=DC900026|Name=DC900026|organism=Citrus sinensis|type=EST|length=481bp
GTAGTTTGCTCGAGTTGCTAACGGAAAAAGGCCACAGATTCAGCAGATTT
CGGTGACAATAACCTAGTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAAT
AAGCGATGTCTTTGATCCAGAACTCATGAAGGAGGATCCAAACATCGAGA
TTGAGCTTCTTCAACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGA
CCATGGAGGAGACCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAAT
CCAAGCCGGTTCAGGACTTGACTCGCAATCTACTATTGCCACTGATGAAG
GAGGTTTCGGTACAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCA
GAACTAAGCACCAAGCCTTAAGCCATTCAATTTTCAGGNCNAGCATTCTT
TCAGTGCCCCAAAATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGTA
TCTCTACCATTTAGGTGTATGTAATCTTTGT
back to top