DC900025

Overview
NameDC900025
Unique NameDC900025
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length592
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9720 contig Csv1_Contig9720:77..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: BRI1_ARATH (Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 6.172e-88
Identity = 158/199 (79.40%), Postives = 177/199 (88.94%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDG-SKECHGAGNLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNSF G IP ELGDCRSLIWLDLNTNLFNG+IP A+FKQSGKIAANFI GK+YVYIKNDG  KECHGAGNLLEF GIR+E+L+R+STR+PCN T RVYGGHT PTF++NGSMMFLD+SYNMLSG IPKEIGSM YLFILNLGHN++SG IP EVGDLRGLNILDLSSN+L+G IP +MS+LT+L EIDL  N L+G IP
Sbjct:  545 NNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIP 743          

HSP 2 Score: 88.9669 bits (219), Expect = 1.959e-17
Identity = 70/208 (33.65%), Postives = 101/208 (48.56%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIP-PALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRV-------YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N FYG +PP  G C  L  L L++N F+G +P   L K  G     ++ N   G+    + N  +       +   F+G     L +    +P N  +        + G   PT ++   ++ L +S+N LSG+IP  +GS+S L  L L  N L G IP E+  ++ L  L L  N L G IPS +S+ T LN I L  N+LTG IP
Sbjct:  326 NHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ----NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIP 529          

HSP 3 Score: 85.8853 bits (211), Expect = 1.658e-16
Identity = 61/183 (33.33%), Postives = 92/183 (50.27%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGK---KYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSM 529
            NN F G+IPP L +C  L+ L L+ N  +G+IP +L   S     K+  N + G+   + +Y+K   +        +L+F  +  E  S +S  +  N+                    + +S N L+G IPK IG +  L IL L +N+ SG IP E+GD R L  LDL++N   GTIP++M
Sbjct:  425 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETL-------ILDFNDLTGEIPSGLSNCTNLNW--------------------ISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM 580          

HSP 4 Score: 75.0998 bits (183), Expect = 2.927e-13
Identity = 70/211 (33.18%), Postives = 98/211 (46.45%), Query Frame = 2
Query:    5 NSFYGRIPPEL-GDCRSLIWLDLNTNLFNGSIPPAL----FKQSGKIAANFIVGKKYV--YIKNDGSKECHGAGNLLEFAGIRAERLSRISTR------SPCNFTRVYGGHTQPTF--NHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G IP  L G C +L  LDL+ N F G++PP        +S  +++N   G+  +   +K  G K    + N  EF+G   E L+ +S        S  NF+    G   P    N   ++  L +  N  +G IP  + + S L  L+L  N LSG IP+ +G L  L  L L  N LEG IP  +  +  L  + L  N LTG IP
Sbjct:  301 NKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN--EFSGELPESLTNLSASLLTLDLSSNNFS----GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIP 505          

HSP 5 Score: 70.0922 bits (170), Expect = 9.417e-12
Identity = 60/198 (30.30%), Postives = 89/198 (44.95%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCR-SLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPT-FNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G +P  L +   SL+ LDL++N F+G I P L +               +Y++N+G            F G     LS  S     + +  Y   T P+       +  L +  NML G IP+E+  +  L  L L  N+L+G IP+ + +   LN + LS+NRL G IP  +  L  L  + L  N  +G IP
Sbjct:  375 NEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE-------LYLQNNG------------FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIP 553          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: BRI1_SOLPE (Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 3.280e-81
Identity = 145/197 (73.60%), Postives = 163/197 (82.74%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G IP ELG+C+SLIWLDLNTN  NGSIPP LFKQSG IA   + GK+YVYIKNDGSKECHGAGNLLEF GIR E+L RISTR PCNFTRVY G TQPTFNHNGSM+FLD+SYN L GSIPKE+G+M YL ILNLGHN+LSG IP ++G L+ + ILDLS NR  GTIP+S++SLTLL EIDL  N L+GMIP
Sbjct:  556 NNSISGNIPAELGNCQSLIWLDLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNLLEFGGIRQEQLDRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIP 752          

HSP 2 Score: 97.8265 bits (242), Expect = 4.217e-20
Identity = 70/207 (33.82%), Postives = 104/207 (50.24%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRIST----RSPCNFTRV-------YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+F G +P  LG+C SL  +D++ N F+G +P     +   I    +   K+V     G  +       LE   + +  L+ I      + P N  +V       + G    + ++   ++ LD+S+N L+GSIP  +GS+S L  L L  N LSG IP E+  L+ L  L L  N L G IP+S+S+ T LN I L  NQL+G IP
Sbjct:  338 NNFSGMVPESLGECSSLELVDISNNNFSGKLPVDTLLKLSNIKTMVLSFNKFV----GGLPDSFSNLPKLETLDMSSNNLTGIIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIP 540          

HSP 3 Score: 77.7962 bits (190), Expect = 4.516e-14
Identity = 53/198 (26.77%), Postives = 94/198 (47.47%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTE-VGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N FYG I   L  C  L +L+L  N F G +P        K+ +  +   +Y+Y++ +            +F G+   +L+ +                        +++ LD+SYN  SG +P+ +G  S L ++++ +NN SG +P + +  L  +  + LS N+  G +P S S+L  L  +D+ +N LTG+IP
Sbjct:  266 SNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVP--------KLPSESL---QYLYLRGN------------DFQGVYPNQLADLCK----------------------TVVELDLSYNNFSGMVPESLGECSSLELVDISNNNFSGKLPVDTLLKLSNIKTMVLSFNKFVGGLPDSFSNLPKLETLDMSSNNLTGIIP 418          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: BRI1_SOLLC (Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 3.280e-81
Identity = 145/197 (73.60%), Postives = 163/197 (82.74%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G IP ELG+C+SLIWLDLNTN  NGSIPP LFKQSG IA   + GK+YVYIKNDGSKECHGAGNLLEF GIR E+L RISTR PCNFTRVY G TQPTFNHNGSM+FLD+SYN L GSIPKE+G+M YL ILNLGHN+LSG IP ++G L+ + ILDLS NR  GTIP+S++SLTLL EIDL  N L+GMIP
Sbjct:  556 NNSISGNIPAELGNCQSLIWLDLNTNFLNGSIPPPLFKQSGNIAVALLTGKRYVYIKNDGSKECHGAGNLLEFGGIRQEQLDRISTRHPCNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIP 752          

HSP 2 Score: 97.0561 bits (240), Expect = 7.194e-20
Identity = 69/207 (33.33%), Postives = 104/207 (50.24%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRIST----RSPCNFTRV-------YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+F G +P  LG+C SL  +D++ N F+G +P     +   I    +   K+V     G  +       LE   + +  L+ +      + P N  +V       + G    + ++   ++ LD+S+N L+GSIP  +GS+S L  L L  N LSG IP E+  L+ L  L L  N L G IP+S+S+ T LN I L  NQL+G IP
Sbjct:  338 NNFSGMVPESLGECSSLELVDISYNNFSGKLPVDTLSKLSNIKTMVLSFNKFV----GGLPDSFSNLLKLETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIP 540          

HSP 3 Score: 79.7221 bits (195), Expect = 1.188e-14
Identity = 53/198 (26.77%), Postives = 94/198 (47.47%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTE-VGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N FYG I   L  C  L +L+L  N F G +P        K+ +  +   +Y+Y++ +            +F G+   +L+ +                        +++ LD+SYN  SG +P+ +G  S L ++++ +NN SG +P + +  L  +  + LS N+  G +P S S+L  L  +D+ +N LTG+IP
Sbjct:  266 SNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVP--------KLPSESL---QYLYLRGN------------DFQGVYPNQLADLCK----------------------TVVELDLSYNNFSGMVPESLGECSSLELVDISYNNFSGKLPVDTLSKLSNIKTMVLSFNKFVGGLPDSFSNLLKLETLDMSSNNLTGVIP 418          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: BRL1_ARATH (Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 4.464e-54
Identity = 96/197 (48.73%), Postives = 134/197 (68.02%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G +P +LG+C+SLIWLDLN+N   G +P  L  Q+G +    + GK++ +++N+G  +C GAG L+EF GIRAERL R+     C  TR+Y G T  TF+ NGSM++ DISYN +SG IP   G+M YL +LNLGHN ++G IP   G L+ + +LDLS N L+G +P S+ SL+ L+++D+  N LTG IP
Sbjct:  532 NNSLSGNVPRQLGNCKSLIWLDLNSNNLTGDLPGELASQAGLVMPGSVSGKQFAFVRNEGGTDCRGAGGLVEFEGIRAERLERLPMVHSCPATRIYSGMTMYTFSANGSMIYFDISYNAVSGFIPPGYGNMGYLQVLNLGHNRITGTIPDSFGGLKAIGVLDLSHNNLQGYLPGSLGSLSFLSDLDVSNNNLTGPIP 728          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: BRL3_ARATH (Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 6.446e-53
Identity = 96/197 (48.73%), Postives = 133/197 (67.51%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G IP ELG+C++LIWLDLN+N   G++P  L  Q+G +    + GK++ +++N+G  +C GAG L+EF GIRAERL        C  TR+Y G T   F+ NGSM++LD+SYN +SGSIP   G+M YL +LNLGHN L+G IP   G L+ + +LDLS N L+G +P S+  L+ L+++D+  N LTG IP
Sbjct:  532 NNSLTGNIPSELGNCKNLIWLDLNSNNLTGNLPGELASQAGLVMPGSVSGKQFAFVRNEGGTDCRGAGGLVEFEGIRAERLEHFPMVHSCPKTRIYSGMTMYMFSSNGSMIYLDLSYNAVSGSIPLGYGAMGYLQVLNLGHNLLTGTIPDSFGGLKAIGVLDLSHNDLQGFLPGSLGGLSFLSDLDVSNNNLTGPIP 728          

HSP 2 Score: 80.1073 bits (196), Expect = 9.100e-15
Identity = 59/183 (32.24%), Postives = 90/183 (49.18%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALF---KQSGKI--AANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSS 535
            NN   G +P ELG C+SL  +DL+ N   G IP  ++   K S  +  A N   G       + G+ E     N L   G   E +S+ +                       +M+++ +S N+L+G IP  IG +  L IL LG+N+L+G IP+E+G+ + L  LDL+SN L G +P  ++S
Sbjct:  411 NNYLSGTVPVELGKCKSLKTIDLSFNALTGLIPKEIWTLPKLSDLVMWANNLTGGIPESICVDGGNLETLILNNNL-LTGSLPESISKCT-----------------------NMLWISLSSNLLTGEIPVGIGKLEKLAILQLGNNSLTGNIPSELGNCKNLIWLDLNSNNLTGNLPGELAS 569          

HSP 3 Score: 78.5666 bits (192), Expect = 2.648e-14
Identity = 58/206 (28.16%), Postives = 96/206 (46.60%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK-QSGKIAANFIVGKKYV-------YIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNF--TRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+  G +P  L +C +L  LDL++N F G +P      QS  +    ++   Y+         K    K    + N L   G+  + +  +   S        + GG  +      G++  L ++ N+L+GS+P+ I   + +  ++L  N L+G IP  +G L  L IL L +N L G IPS + +   L  +DL +N LTG +P
Sbjct:  361 NNISGSVPISLTNCSNLRVLDLSSNEFTGEVPSGFCSLQSSSVLEKLLIANNYLSGTVPVELGKCKSLKTIDLSFNAL--TGLIPKEIWTLPKLSDLVMWANNLTGGIPESICVDGGNLETLILNNNLLTGSLPESISKCTNMLWISLSSNLLTGEIPVGIGKLEKLAILQLGNNSLTGNIPSELGNCKNLIWLDLNSNNLTGNLP 564          

HSP 4 Score: 77.7962 bits (190), Expect = 4.516e-14
Identity = 64/209 (30.62%), Postives = 101/209 (48.33%), Query Frame = 2
Query:    5 NSFYGRIPPE--LGDCRSLIWLDLNTNLFNGSIPPAL-----FKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLL---EFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPK---EIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NS  G+IP +   G+ ++L  L L  NL++G IPP L       +   ++ N + G+      + GS +    GN     +F      +LSRI T     F  +  G    +  +  ++  LD+S N  +G +P     + S S L  L + +N LSG +P E+G  + L  +DLS N L G IP  + +L  L+++ +  N LTG IP
Sbjct:  261 NSLIGKIPGDDYWGNFQNLRQLSLAHNLYSGEIPPELSLLCRTLEVLDLSGNSLTGQLPQSFTSCGSLQSLNLGNNKLSGDFLSTVVSKLSRI-TNLYLPFNNI-SGSVPISLTNCSNLRVLDLSSNEFTGEVPSGFCSLQSSSVLEKLLIANNYLSGTVPVELGKCKSLKTIDLSFNALTGLIPKEIWTLPKLSDLVMWANNLTGGIP 467          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: BRL2_ARATH (Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 9.633e-49
Identity = 97/198 (48.99%), Postives = 126/198 (63.64%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG-KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN+F G IPPELG C +L+WLDLNTN   G IPP L +Q G K  +  + G    +++N G+  C G G L+EF+GIR ERL +I +   C+FTR+Y G     F    ++ +LD+SYN L G IP EIG M  L +L L HN LSG IP  +G L+ L + D S NRL+G IP S S+L+ L +IDL  N+LTG IP
Sbjct:  504 NNNFTGEIPPELGKCTTLVWLDLNTNHLTGEIPPRLGRQPGSKALSGLLSGNTMAFVRNVGN-SCKGVGGLVEFSGIRPERLLQIPSLKSCDFTRMYSGPILSLFTRYQTIEYLDLSYNQLRGKIPDEIGEMIALQVLELSHNQLSGEIPFTIGQLKNLGVFDASDNRLQGQIPESFSNLSFLVQIDLSNNELTGPIP 700          

HSP 2 Score: 82.4185 bits (202), Expect = 1.834e-15
Identity = 71/228 (31.14%), Postives = 109/228 (47.81%), Query Frame = 2
Query:    2 NNSFYGRIPPELGD-CRSLIWLDLNTNLFNGSIPPAL----FKQSGKIAANFIVGK-KYVYIKNDGSKECHGAGNLL---EF-AGIRAERLSRISTRSPCNFTRVYG---------------------GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G IPPE+GD CRSL  L L+ N F G IP +L    + QS  ++ N I G      +++ GS +     N L   +F   I A +  RI+  S   F+ V                       G   P  +    +  +D+S N L+G+IP EIG++  L      +NN++G IP E+G L+ L  L L++N+L G IP    + + +  +   +N+LTG +P
Sbjct:  261 HNRLTGWIPPEIGDTCRSLQNLRLSYNNFTGVIPESLSSCSWLQSLDLSNNNISGPFPNTILRSFGSLQILLLSNNLISGDFPTSISACKSLRIADFSSNRFSGVIPPDLCPGAASLEELRLPDNLVTGEIPPAISQCSELRTIDLSLNYLNGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGKLQNLKDLILNNNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVP 488          

HSP 3 Score: 67.3958 bits (163), Expect = 6.104e-11
Identity = 56/189 (29.63%), Postives = 86/189 (45.50%), Query Frame = 2
Query:   35 LGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGS-KECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHN-GSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIP-TEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            L  C S+ +LD + N  +G I  +L   +   + N        Y   DG   +  G   LL+   +   RL+               G   P       S+  L +SYN  +G IP+ + S S+L  L+L +NN+SGP P T +     L IL LS+N + G  P+S+S+   L   D  +N+ +G+IP
Sbjct:  200 LSSCVSMTYLDFSGNSISGYISDSLINCTNLKSLNLS------YNNFDGQIPKSFGELKLLQSLDLSHNRLT---------------GWIPPEIGDTCRSLQNLRLSYNNFTGVIPESLSSCSWLQSLDLSNNNISGPFPNTILRSFGSLQILLLSNNLISGDFPTSISACKSLRIADFSSNRFSGVIP 367          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: PEPR2_ARATH (Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.642e-22
Identity = 71/198 (35.86%), Postives = 101/198 (51.01%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGS-KECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN FYG IP  LG  RSL  +DL  N F G IPP L    G+    FI+G   ++ K   S ++C      LE   +   +LS +                 P F  + S+ ++++  N   GSIP+ +GS   L  ++L  N L+G IP E+G+L+ L +L+LS N LEG +PS +S    L   D+G+N L G IP
Sbjct:  397 NNGFYGDIPMSLGLNRSLEEVDLLGNRFTGEIPPHLCH--GQKLRLFILGSNQLHGKIPASIRQC----KTLERVRLEDNKLSGVL----------------PEFPESLSLSYVNLGSNSFEGSIPRSLGSCKNLLTIDLSQNKLTGLIPPELGNLQSLGLLNLSHNYLEGPLPSQLSGCARLLYFDVGSNSLNGSIP 572          

HSP 2 Score: 90.8929 bits (224), Expect = 5.155e-18
Identity = 70/224 (31.25%), Postives = 107/224 (47.77%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQ-------------SGKIAANF-----IVGKKYVYIKNDGS-KECHGAGNLLEFAGIRAERLSRISTRSPC---NFTRVY------GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NSF G +P  LG+C SL +LDL+ N F+G +P                   SG I A+      +V  +  Y    G+  E  G  + LE+  +   +L+     S     N   ++      GG      ++   ++ LD+S+N   G +P EIG+ S L  L +   NL+G IP+ +G LR ++++DLS NRL G IP  + + + L  + L  NQL G IP
Sbjct:  110 NSFSGLLPSTLGNCTSLEYLDLSNNDFSGEVPDIFGSLQNLTFLYLDRNNLSGLIPASVGGLIELVDLRMSYNNLSGTIPELLGNCSKLEYLALNNNKLNGSLPASLYLLENLGELFVSNNSLGGRLHFGSSNCKKLVSLDLSFNDFQGGVPPEIGNCSSLHSLVMVKCNLTGTIPSSMGMLRKVSVIDLSDNRLSGNIPQELGNCSSLETLKLNDNQLQGEIP 333          

HSP 3 Score: 87.8113 bits (216), Expect = 4.364e-17
Identity = 59/196 (30.10%), Postives = 96/196 (48.98%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+  G IP  LG+C  L +L LN N  NGS+P +L+           +G+ +V   + G +   G+ N  +   +              +F    GG   P   +  S+  L +    L+G+IP  +G +  + +++L  N LSG IP E+G+   L  L L+ N+L+G IP ++S L  L  ++L  N+L+G IP
Sbjct:  182 NNLSGTIPELLGNCSKLEYLALNNNKLNGSLPASLYLLEN-------LGELFVSNNSLGGRLHFGSSNCKKLVSL------------DLSFNDFQGG-VPPEIGNCSSLHSLVMVKCNLTGTIPSSMGMLRKVSVIDLSDNRLSGNIPQELGNCSSLETLKLNDNQLQGEIPPALSKLKKLQSLELFFNKLSGEIP 357          

HSP 4 Score: 82.8037 bits (203), Expect = 1.404e-15
Identity = 58/195 (29.74%), Postives = 93/195 (47.69%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNI-LDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTG 583
            +NSF G IP  LG C++L+ +DL+ N   G IPP L    G + +  ++   + Y++     +  G   LL F          + + S         G    +F    S+  L +S N   G+IP+ +  +  L  L +  N   G IP+ VG L+ L   LDLS+N   G IP+++ +L  L  +++  N+LTG
Sbjct:  492 SNSFEGSIPRSLGSCKNLLTIDLSQNKLTGLIPPEL----GNLQSLGLLNLSHNYLEGPLPSQLSGCARLLYFD---------VGSNS-------LNGSIPSSFRSWKSLSTLVLSDNNFLGAIPQFLAELDRLSDLRIARNAFGGKIPSSVGLLKSLRYGLDLSANVFTGEIPTTLGALINLERLNISNNKLTG 666          

HSP 5 Score: 75.0998 bits (183), Expect = 2.927e-13
Identity = 61/201 (30.35%), Postives = 88/201 (43.78%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G IP ELG+C SL  L LN N   G IPPAL K    QS ++  N + G+  + I    S       N      +  E       +    F   + G    +   N S+  +D+  N  +G IP  +     L +  LG N L G IP  +   + L  + L  N+L G +P    SL+ L+ ++LG+N   G IP
Sbjct:  301 DNRLSGNIPQELGNCSSLETLKLNDNQLQGEIPPALSKLKKLQSLELFFNKLSGEIPIGIWKIQSLTQMLVYNNTLTGELPVEVTQLKHLKKLTLFNNGFYGDIPMSLGLNRSLEEVDLLGNRFTGEIPPHLCHGQKLRLFILGSNQLHGKIPASIRQCKTLERVRLEDNKLSGVLPEFPESLS-LSYVNLGSNSFEGSIP 500          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: ERL2_ARATH (LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.004e-21
Identity = 71/207 (34.30%), Postives = 104/207 (50.24%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGS-KECHGAGNLL------EFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G+IPPELG+   L +L LN N   G IPP L K        +A N +VG     I +  +  + +  GN L      EF  + +     +S+ S       + G       H  ++  LD+S N  SGSIP  +G + +L ILNL  N+L+G +P E G+LR + I+D+S N L G IP+ +  L  +N + L  N++ G IP
Sbjct:  322 NKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNS-------FKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIPTELGQLQNINSLILNNNKIHGKIP 521          

HSP 2 Score: 91.2781 bits (225), Expect = 3.947e-18
Identity = 74/206 (35.92%), Postives = 103/206 (50.00%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYI-KNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYG----GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G IPP LG+      L L+ N   G IPP L   S     ++  N +VGK    + K +   E + A N L   G+     S IS+ +  N   V+G    G     F + GS+ +L++S N   G IP E+G +  L  L+L  NN SG IP  +GDL  L IL+LS N L GT+P+   +L  +  ID+  N L G+IP
Sbjct:  297 DNELTGPIPPILGNLSFTGKLYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNL--VGLIP---SNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIP 497          

HSP 3 Score: 80.8777 bits (198), Expect = 5.335e-15
Identity = 67/247 (27.13%), Postives = 105/247 (42.51%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVG------------KKYVYIKNDGSKECHGA---GNLLEFAGIRAERLSRISTRSPCNFTRVY---------GGHTQPTFNHNGSMMFLDISYNM-----------------------LSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G+IP E+G+C SL ++D +TNL  G IP ++ K        +  N + G            K     +N  + E         +L++ G+R   L+   +   C  T ++          G    +  +  S   LD+SYN                        L+G IP+ IG M  L +L+L  N L+GPIP  +G+L     L L  N+L G IP  + +++ L+ + L  N+L G IP
Sbjct:  107 NKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWNEVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIP 353          

HSP 4 Score: 70.8626 bits (172), Expect = 5.521e-12
Identity = 57/197 (28.93%), Postives = 85/197 (43.15%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPAL-FKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+  G IP  +G+C S   LD++ N   G IP  + F Q   +A   + G K               G + E  G+                                ++  LD+S N L+G IP  +G++S+   L L  N L+G IP E+G++  L+ L L+ N L G IP  +  L  L E++L  N L G+IP
Sbjct:  227 NNLTGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQ---VATLSLQGNKLT-------------GRIPEVIGLMQ------------------------------ALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIP 377          

HSP 5 Score: 68.1662 bits (165), Expect = 3.578e-11
Identity = 36/101 (35.64%), Postives = 54/101 (53.47%), Query Frame = 2
Query:  290 GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            GG          ++  +D+  N L G IP EIG+   L  ++   N L G IP  +  L+ L  L+L +N+L G IP++++ +  L  +DL  NQLTG IP
Sbjct:   86 GGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIP 186          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: RPK1_IPONI (Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 1.712e-21
Identity = 73/203 (35.96%), Postives = 104/203 (51.23%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNL----LEFAGIRAERLSRISTRSPCNFT---RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G IP +LG   SL  LDL  N+F G IPP L  Q  K     ++G  Y Y++     +  G   L    LE   +R      +  ++   F      + G   P+  +  ++  + +S N LSGSIP E+GS+  L  LNL HN L G +P+E+ +   L+ LD S N L G+IPS++ SLT L ++ LG N  +G IP
Sbjct:  414 NHFTGVIPQDLGANSSLEVLDLTRNMFTGHIPPNLCSQ--KKLKRLLLG--YNYLEGSVPSDLGGCSTLERLILEENNLRGGLPDFVEKQNLLFFDLSGNNFTGPIPPSLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGILPSELSNCHKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSFSGGIP 612          

HSP 2 Score: 84.7297 bits (208), Expect = 3.695e-16
Identity = 58/197 (29.44%), Postives = 88/197 (44.67%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G IP +   C+ +  + L+ N F G +PP L   +               ++  G+  C  +G +    G    +L+++ T         + G   P      SM+ L +  N L G IP E+G +S L  L+L  NNLSG +P  +  ++ L  L L  N L G +P  M+ L  L  + L  N  TG+IP
Sbjct:  245 NNSLVGAIPLDFVSCKQIDTISLSNNQFTGGLPPGLGNCTS--------------LREFGAFSCALSGPIPSCFG----QLTKLDTLYLAG--NHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGELGMLSQLQYLHLYTNNLSGEVPLSIWKIQSLQSLQLYQNNLSGELPVDMTELKQLVSLALYENHFTGVIP 421          

HSP 3 Score: 80.1073 bits (196), Expect = 9.100e-15
Identity = 64/218 (29.36%), Postives = 99/218 (45.41%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTE-----------------------VGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMI 589
            N+F G IPP LG+ +++  + L++N  +GSIPP L           +V  +++ + +          N+L+  GI    LS     S                        LD S+N+L+GSIP  +GS++ L  L+LG N+ SG IPT                        VG L+ L  L+LSSN+L G +P  +  L +L E+D+  N L+G +
Sbjct:  509 NNFTGPIPPSLGNLKNVTAIYLSSNQLSGSIPPEL---------GSLVKLEHLNLSH----------NILK--GILPSELSNCHKLSE-----------------------LDASHNLLNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLNLQLGGNLLAGDIPPVGALQALRSLNLSSNKLNGQLPIDLGKLKMLEELDVSHNNLSGTL 682          

HSP 4 Score: 68.9366 bits (167), Expect = 2.098e-11
Identity = 61/202 (30.20%), Postives = 89/202 (44.06%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLS--RISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IP  +G+   L  L L+ N F+G +P +L      Q   +  N +VG   V + N  +       N      I  + +S  +I T S  N    + G   P   +  S+         LSG IP   G ++ L  L L  N+ SG IP E+G  + +  L L  N+LEG IP  +  L+ L  + L TN L+G +P
Sbjct:  174 NGLNGSIPSNIGNMSELTTLWLDDNQFSGPVPSSLGNITTLQELYLNDNNLVGTLPVTLNNLENLVYLDVRNNSLVGAIPLDFVSCKQIDTISLSN--NQFTGGLPPGLGNCTSLREFGAFSCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGELGMLSQLQYLHLYTNNLSGEVP 373          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: EXS_ARATH (Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 6.506e-21
Identity = 69/201 (34.33%), Postives = 99/201 (49.25%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLL----EFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN F G IP E+ DC  L  L L +NL +GSIP  L   SG + A  + G        +    C   G LL    +  G   E L ++   +    +  + G    +   + ++M    SYN L G +P EIG+ + L  L L  N L+G IP E+G L  L++L+L++N  +G IP  +   T L  +DLG+N L G IP
Sbjct:  338 NNRFSGEIPHEIEDCPMLKHLSLASNLLSGSIPRELCG-SGSLEAIDLSGNLLSGTIEEVFDGCSSLGELLLTNNQINGSIPEDLWKLPLMALDLDSNNFTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEIPREIGKLTSLSVLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIP 537          

HSP 2 Score: 93.2041 bits (230), Expect = 1.039e-18
Identity = 65/196 (33.16%), Postives = 85/196 (43.37%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G+IP ELGDC SL  LDL +N   G IP  +   +                              L+   +    LS      P  +             H+G     D+SYN LSG IP+E+G    L  ++L +N+LSG IP  +  L  L ILDLS N L G+IP  M +   L  ++L  NQL G IP
Sbjct:  506 NMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQ-----------------------------LQCLVLSYNNLSGSIPSKPSAYFHQIEMPDLSFLQHHG---IFDLSYNRLSGPIPEELGECLVLVEISLSNNHLSGEIPASLSRLTNLTILDLSGNALTGSIPKEMGNSLKLQGLNLANNQLNGHIP 669          

HSP 3 Score: 83.9593 bits (206), Expect = 6.302e-16
Identity = 58/200 (29.00%), Postives = 94/200 (47.00%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IP ELG+C  L+ + L+ N  +G IP +L + +      ++ N + G           KE    GN L+  G+                     GH   +F   GS++ L+++ N L G +P  +G++  L  ++L  NNLSG + +E+  +  L  L +  N+  G IPS + +LT L  +D+  N L+G IP
Sbjct:  590 NRLSGPIPEELGECLVLVEISLSNNHLSGEIPASLSRLTNLTILDLSGNALTGSI--------PKEM---GNSLKLQGLNLAN-------------NQLNGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTMEKLVGLYIEQNKFTGEIPSELGNLTQLEYLDVSENLLSGEIP 765          

HSP 4 Score: 75.485 bits (184), Expect = 2.241e-13
Identity = 62/197 (31.47%), Postives = 85/197 (43.15%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G IPPE+G   +L  L +  N F+G IP     + G I+           +KN  +  C        F G   + +S++                         +  LD+SYN L  SIPK  G +  L ILNL    L G IP E+G+ + L  L LS N L G +P  +S + LL       NQL+G +P
Sbjct:  171 NNSLSGEIPPEIGKLSNLSNLYMGLNSFSGQIP----SEIGNIS----------LLKNFAAPSCF-------FNGPLPKEISKLK-----------------------HLAKLDLSYNPLKCSIPKSFGELHNLSILNLVSAELIGLIPPELGNCKSLKSLMLSFNSLSGPLPLELSEIPLLT-FSAERNQLSGSLP 322          

HSP 5 Score: 69.707 bits (169), Expect = 1.230e-11
Identity = 59/197 (29.95%), Postives = 89/197 (45.18%), Query Frame = 2
Query:    8 SFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHN-GSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            S  G+IP E+   ++L  L L  N F+G IPP ++        +                    +GN L   G+    LS +      + +   + G   P+F  +  ++  LD+S N LSG IP EIG +S L  L +G N+ SG IP+E+G++  L      S    G +P  +S L  L ++DL  N L   IP
Sbjct:   76 SLRGQIPKEISSLKNLRELCLAGNQFSGKIPPEIWNLKHLQTLDL-------------------SGNSL--TGLLPRLLSELPQLLYLDLSDNHFSGSLPPSFFISLPALSSLDVSNNSLSGEIPPEIGKLSNLSNLYMGLNSFSGQIPSEIGNISLLKNFAAPSCFFNGPLPKEISKLKHLAKLDLSYNPLKCSIP 251          
The following BLAST results are available for this feature:
BLAST of DC900025 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
BRI1_ARATH6.172e-8879.40Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidops... [more]
BRI1_SOLPE3.280e-8173.60Systemin receptor SR160 OS=Solanum peruvianum PE=1... [more]
BRI1_SOLLC3.280e-8173.60Brassinosteroid LRR receptor kinase OS=Solanum lyc... [more]
BRL1_ARATH4.464e-5448.73Serine/threonine-protein kinase BRI1-like 1 OS=Ara... [more]
BRL3_ARATH6.446e-5348.73Receptor-like protein kinase BRI1-like 3 OS=Arabid... [more]
BRL2_ARATH9.633e-4948.99Serine/threonine-protein kinase BRI1-like 2 OS=Ara... [more]
PEPR2_ARATH2.642e-2235.86Leucine-rich repeat receptor-like protein kinase P... [more]
ERL2_ARATH1.004e-2134.30LRR receptor-like serine/threonine-protein kinase ... [more]
RPK1_IPONI1.712e-2135.96Receptor-like protein kinase OS=Ipomoea nil GN=INR... [more]
EXS_ARATH6.506e-2134.33Leucine-rich repeat receptor protein kinase EXS OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900025 VSS Citrus sinensis cDNA clone VS27Q33 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900025 ID=DC900025|Name=DC900025|organism=Citrus sinensis|type=EST|length=592bp
CAACAACTCCTTTTATGGTAGGATCCCTCCGGAGCTTGGAGATTGTCGAA
GCTTGATATGGTTGGATCTTAATACCAACTTATTTAATGGATCCATCCCT
CCTGCATTGTTCAAGCAATCTGGTAAAATTGCGGCTAACTTTATTGTGGG
GAAGAAGTATGTGTATATCAAGAATGATGGTAGCAAAGAGTGTCATGGAG
CTGGAAACTTGCTCGAGTTTGCAGGAATTAGAGCTGAGCGGTTGAGCAGA
ATTTCCACCAGGAGCCCCTGCAACTTCACTAGAGTATATGGAGGTCACAC
TCAGCCTACATTTAACCATAATGGATCGATGATGTTTCTTGATATTTCGT
ACAACATGCTGTCGGGTAGCATTCCGAAGGAGATTGGTTCTATGTCATAT
CTTTTCATCTTGAATTTGGGCCATAACAATCTCTCCGGTCCTATTCCAAC
AGAGGTGGGAGACTTACGAGGTCTTAACATTCTTGACCTCTCGAGCAACA
GGCTTGAAGGGACAATTCCATCATCCATGAGTTCTCTTACGTTGCTTAAT
GAGATTGATCTGGGCACCAACCAACTCACTGGTATGATTCCT
back to top