DC900023

Overview
NameDC900023
Unique NameDC900023
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length607
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4068 contig Csv1_Contig4068:393..999. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: VPE_CITSI (Vacuolar-processing enzyme OS=Citrus sinensis PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 7.424e-68
Identity = 121/200 (60.50%), Postives = 154/200 (77.00%), Query Frame = 3
Query:    3 FLAVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIGTNPDTDTXTMKAE 602
            F AV+LGN+TALTGGSGKVV+SGPND+IFI+Y+DHG  G++ MPT   +YA +LI+VLKKKH + +YKS+VFYLEACESGS+F+GLL E +NIYA TAS   ESS+  YCPG  P P  ++ TCLGDL+SI+W+EDS+ H+L+ ETL QQ+ +V+ RT   Y  + SHVMQYG+  LSK  +FTY+GTNP  D  T   E
Sbjct:  144 FFAVVLGNKTALTGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSRYIYADELIDVLKKKHASGNYKSLVFYLEACESGSIFEGLLLEGLNIYATTASNAEESSWGTYCPGEIPGPPPEYSTCLGDLYSIAWMEDSDIHNLRTETLHQQYELVKTRT-ASYNSYGSHVMQYGDIGLSKNNLFTYLGTNPANDNYTFVDE 342          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: VPEA_ARATH (Vacuolar-processing enzyme alpha-isozyme OS=Arabidopsis thaliana GN=At2g25940 PE=2 SV=2)

HSP 1 Score: 254.988 bits (650), Expect = 2.160e-67
Identity = 120/199 (60.30%), Postives = 155/199 (77.89%), Query Frame = 3
Query:    6 LAVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIGTNPDTDTXTMKAE 602
            LAVILGN+TAL GGSGKVV+SGPND+IFIYY+DHG  G++ MPT  +LYA DL +VLKKK+ + +YKS+VFYLEACESGS+F+GLL E +NIYA TAS   ESS+  YCPG  PSP  ++ETCLGDL+S++WIEDSEKH+LQ ETL +Q+ +V++RT      + SHVM++G+  LSKE +  ++GTNP  +  T   E
Sbjct:  129 LAVILGNKTALKGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTSPNLYANDLNDVLKKKYASGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEDPSPPSEYETCLGDLYSVAWIEDSEKHNLQTETLHEQYELVKKRTAGSGKSYGSHVMEFGDIGLSKEKLVLFMGTNPADENFTFVNE 327          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: VPE_VICSA (Vacuolar-processing enzyme OS=Vicia sativa PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.400e-66
Identity = 118/200 (59.00%), Postives = 153/200 (76.50%), Query Frame = 3
Query:    3 FLAVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIGTNPDTDTXTMKAE 602
            F A +LGN++ALTGGSGKVV+SGPND+IF+YY DHG  G++ MP G  LYA DL EVLKKKH + +YKS+VFYLEACESGS+F+GLL +D+NIYA TAS   ESS+  YCPG  P P  ++ TCLGDL+SI+W+EDSE H+LQ E+LQQQ+ +V+ RT+ +   + SHVM+YG+  LSK  ++ Y+GTNP  D  +   E
Sbjct:  140 FYAALLGNKSALTGGSGKVVDSGPNDHIFVYYTDHGGPGVLGMPVGPYLYASDLNEVLKKKHASGTYKSLVFYLEACESGSIFEGLLPDDLNIYATTASNAEESSWGYYCPGDKPPPPPEYSTCLGDLYSIAWMEDSEVHNLQTESLQQQYKLVKNRTISE--PYGSHVMEYGDIGLSKNDLYQYLGTNPANDNNSFVDE 337          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: VPE1_PHAVU (Vacuolar-processing enzyme OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.185e-65
Identity = 114/200 (57.00%), Postives = 154/200 (77.00%), Query Frame = 3
Query:    3 FLAVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIGTNPDTDTXTMKAE 602
            F A +LG+++ LTGGSGKVVNSGPND+IFI+Y+DHG  G++  P G  +YA DL EVLKKKH + +YK++VFYLEACESGS+F+GLL ED+N+YA TAS   ESS+  YCPG  PSP  ++ TCLGDL+S++W+EDS++H+L+ ETL QQ+ +V+ RT+   L + SHVMQYG+  LSK+ +F Y+GT+P  +  T   E
Sbjct:  133 FYAALLGDKSKLTGGSGKVVNSGPNDHIFIFYSDHGGPGVLGSPAGPYIYASDLNEVLKKKHASGTYKNLVFYLEACESGSIFEGLLPEDINVYATTASNADESSWGTYCPGEDPSPPPEYSTCLGDLYSVAWMEDSDRHNLRTETLHQQYKLVKERTISGGLYYGSHVMQYGDVGLSKDILFHYLGTDPANENLTFVDE 332          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: VPEG_ARATH (Vacuolar-processing enzyme gamma-isozyme OS=Arabidopsis thaliana GN=At4g32940 PE=2 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 3.449e-65
Identity = 117/194 (60.31%), Postives = 149/194 (76.80%), Query Frame = 3
Query:    9 AVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIGTNPDTDTXT 590
            AVILG++TA+ GGSGKVV+SGPND+IFI+Y+DHG  G++ MPT   LYA DL +VLKKKH   +YKS+VFYLEACESGS+F+GLL E +NIYA TAS   ESS+  YCPG  PSP  ++ETCLGDL+S++W+EDS  H+LQ ETL QQ+ +V+RRT      + SHVMQYG+  +SK+ +  Y+GTNP  D  T
Sbjct:  145 AVILGDKTAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHALGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEEPSPPPEYETCLGDLYSVAWMEDSGMHNLQTETLHQQYELVKRRTAPVGYSYGSHVMQYGDVGISKDNLDLYMGTNPANDNFT 338          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: VPEB_ARATH (Vacuolar-processing enzyme beta-isozyme OS=Arabidopsis thaliana GN=At1g62710 PE=2 SV=3)

HSP 1 Score: 226.483 bits (576), Expect = 8.227e-59
Identity = 105/194 (54.12%), Postives = 143/194 (73.71%), Query Frame = 3
Query:    3 FLAVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFS--SHVMQYGNKELSKEPIFTYIGTNPDT 578
            F AV+LG++ A+ GGSGKV+ S PND+IF+YYADHG  G++ MP    +YA D IE LKKKH + +YK MV Y+EACESGS+F+G++ +D+NIY  TAS   ESSY  YCPG  PSP  ++ TCLGDL+S++W+EDSE H+L+KET++QQ+  V+ RT  +Y  +S  SHVM+YGN  +  E ++ Y G +P T
Sbjct:  135 FYAVLLGDQKAVKGGSGKVIASKPNDHIFVYYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYSVAWMEDSETHNLKKETIKQQYHTVKMRT-SNYNTYSGGSHVMEYGNNSIKSEKLYLYQGFDPAT 327          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: LEGU_CANEN (Legumain OS=Canavalia ensiformis PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 3.457e-57
Identity = 101/191 (52.88%), Postives = 141/191 (73.82%), Query Frame = 3
Query:    9 AVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTL-VDYLDFSSHVMQYGNKELSKEPIFTYIGTNPDT 578
            AVILG+++ + GGSGKV+NS P D IFI+Y+DHG  G++ MP    +YA D I+VLKKKH +  YK MV Y+EACESGS+F+G++ +D+NIY  TAS   E+S+  YCPG  P P +++ TCLGDL+S+SW+EDSE H+L++ET+QQQ+  VR+RT   +   F SHVMQYG+  ++ E ++ Y G +P T
Sbjct:  126 AVILGDKSKVKGGSGKVINSNPEDRIFIFYSDHGGPGVLGMPNAPFVYAMDFIDVLKKKHASGGYKEMVIYIEACESGSIFEGIMPKDLNIYVTTASNAQENSFGTYCPGMNPPPPEEYVTCLGDLYSVSWMEDSETHNLKRETVQQQYQSVRKRTSNSNSYRFGSHVMQYGDTNITAEKLYLYHGFDPAT 316          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: VPE_RICCO (Vacuolar-processing enzyme OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.314e-56
Identity = 103/190 (54.21%), Postives = 143/190 (75.26%), Query Frame = 3
Query:    9 AVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFS--SHVMQYGNKELSKEPIFTYIGTNP 572
            AV+LG+++A+ GGSGKVV+S PND IF+YY+DHG  G++ MP    LYA D IEVLKKKH A  YK MV Y+EACESGS+F+G++ +D++IY  TAS   ESS+  YCPG  PSP  +F TCLGDL+S++W+EDSE H+L+KET++QQ+  V+ RT  +Y  ++  SHVMQYGN+ +  + ++ + G +P
Sbjct:  148 AVLLGDKSAVQGGSGKVVDSKPNDRIFLYYSDHGGPGVLGMPNLPYLYAMDFIEVLKKKHAAGGYKKMVIYVEACESGSIFEGIMPKDVDIYVTTASNAQESSWGTYCPGMEPSPPPEFTTCLGDLYSVAWMEDSESHNLKKETVKQQYSSVKART-SNYNTYAAGSHVMQYGNQSIKADKLYLFQGFDP 336          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: VPE2_PHAVU (Vacuolar-processing enzyme OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.716e-56
Identity = 99/193 (51.30%), Postives = 141/193 (73.06%), Query Frame = 3
Query:    3 FLAVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTL-VDYLDFSSHVMQYGNKELSKEPIFTYIGTNPDT 578
            F AV+LG+++ + GGSGKV+NS P D IF+YY+DHG  G++ MP    LYA D I+VLKKKH +  YK MV Y+EACESGS+F+G++ +D+NIY  TAS   E+S+  YCPG YP P  ++ TCLGDL+S++W+EDSE H+L+KE+++QQ+  V++RT   +     SHVMQYG+  ++ E ++ Y G +P T
Sbjct:  142 FFAVLLGDKSKVKGGSGKVINSKPEDRIFVYYSDHGGPGVLGMPNMPYLYAMDFIDVLKKKHASGGYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQENSWGTYCPGMYPPPPPEYITCLGDLYSVAWMEDSESHNLKKESVEQQYQSVKQRTSNFEAYAMGSHVMQYGDANMTAEKLYLYHGFDPAT 334          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: VPE_SOYBN (Vacuolar-processing enzyme OS=Glycine max PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.112e-55
Identity = 101/191 (52.88%), Postives = 141/191 (73.82%), Query Frame = 3
Query:    9 AVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTL-VDYLDFSSHVMQYGNKELSKEPIFTYIGTNPDT 578
            AVILG+++ L GGSGKV+NS P D IFIYY+DHG  G++ MP    LYA D I+VLKKKH + SYK MV Y+EACESGS+F+G++ +D+NIY  TAS   E+S+  YCPG  PSP  ++ TCLGDL+S++W+EDSE H+L++E+++QQ+  V++RT   +     SHVMQYG+  ++ E ++ Y G +P T
Sbjct:  146 AVILGDKSKLKGGSGKVINSKPEDRIFIYYSDHGGPGILGMPNMPYLYAMDFIDVLKKKHASGSYKEMVIYVEACESGSVFEGIMPKDLNIYVTTASNAQENSWGTYCPGMDPSPPPEYITCLGDLYSVAWMEDSEAHNLKRESVKQQYKSVKQRTSNFNNYAMGSHVMQYGDTNITAEKLYLYQGFDPAT 336          
The following BLAST results are available for this feature:
BLAST of DC900023 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
VPE_CITSI7.424e-6860.50Vacuolar-processing enzyme OS=Citrus sinensis PE=2... [more]
VPEA_ARATH2.160e-6760.30Vacuolar-processing enzyme alpha-isozyme OS=Arabid... [more]
VPE_VICSA1.400e-6659.00Vacuolar-processing enzyme OS=Vicia sativa PE=1 SV... [more]
VPE1_PHAVU1.185e-6557.00Vacuolar-processing enzyme OS=Phaseolus vulgaris P... [more]
VPEG_ARATH3.449e-6560.31Vacuolar-processing enzyme gamma-isozyme OS=Arabid... [more]
VPEB_ARATH8.227e-5954.12Vacuolar-processing enzyme beta-isozyme OS=Arabido... [more]
LEGU_CANEN3.457e-5752.88Legumain OS=Canavalia ensiformis PE=1 SV=1[more]
VPE_RICCO1.314e-5654.21Vacuolar-processing enzyme OS=Ricinus communis PE=... [more]
VPE2_PHAVU1.716e-5651.30Vacuolar-processing enzyme OS=Phaseolus vulgaris P... [more]
VPE_SOYBN1.112e-5552.88Vacuolar-processing enzyme OS=Glycine max PE=2 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900023 VSS Citrus sinensis cDNA clone VS27Q32 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900023 ID=DC900023|Name=DC900023|organism=Citrus sinensis|type=EST|length=607bp
ATTTTCTGGCGGTGATTCTCGGCAACAGAACTGCACTCACCGGGGGCAGT
GGCAAGGTTGTAAATAGTGGTCCGAATGACTATATTTTTATTTATTATGC
AGACCATGGAAGCGCTGGTATGGTCGCAATGCCTACTGGAGATGACCTCT
ACGCTAAAGATTTGATAGAGGTGTTAAAAAAGAAACACGAGGCTAAATCT
TATAAAAGCATGGTATTTTACCTTGAGGCTTGTGAATCCGGAAGCATGTT
TGATGGGCTTCTCACGGAAGACATGAACATATATGCAGTCACGGCTTCAA
CTCCCGCAGAGAGCAGCTACGCGATGTATTGTCCCGGGCATTATCCGAGT
CCCGAGGATGATTTTGAAACTTGTTTGGGTGATCTCTTCAGTATTTCTTG
GATTGAAGATAGTGAAAAACATGATTTACAGAAGGAAACACTACAGCAAC
AACATGGAGTGGTTCGGAGGAGGACATTGGTAGATTATTTAGACTTTAGC
TCTCATGTAATGCAGTACGGAAACAAAGAGCTGAGCAAAGAGCCAATTTT
TACGTATATTGGCACGAATCCTGATACCGACACCTTNACGATGAAGGCTG
AAGAATT
back to top