DC900020

Overview
NameDC900020
Unique NameDC900020
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length512
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:314..824. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900020 vs. ExPASy Swiss-Prot
Match: CYPH_CATRO (Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus GN=PCKR1 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 8.176e-34
Identity = 69/80 (86.25%), Postives = 71/80 (88.75%), Query Frame = 1
Query:   31 ENXXKKHTGPGILSMANAGPATNGSQXFVCTAKTXWLDGKHXVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 270
            EN  KKHTGPGILSMANAGP TNGSQ F+CTAKT WLDGKH VFGQVVEGMDVVKAIEKVGSSSGRT K VV+ DCGQLS
Sbjct:   93 ENFIKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTAKKVVVEDCGQLS 172          
BLAST of DC900020 vs. ExPASy Swiss-Prot
Match: CYPH_ALLCE (Peptidyl-prolyl cis-trans isomerase OS=Allium cepa GN=CYP PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.107e-33
Identity = 66/80 (82.50%), Postives = 70/80 (87.50%), Query Frame = 1
Query:   31 ENXXKKHTGPGILSMANAGPATNGSQXFVCTAKTXWLDGKHXVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 270
            EN  KKHTGPG+LSMANAGP TNGSQ F+CT KT WLDGKH VFGQVVEGMDVV+AIEKVGS SG+T KPV IADCGQLS
Sbjct:   71 ENFIKKHTGPGVLSMANAGPGTNGSQFFICTEKTAWLDGKHVVFGQVVEGMDVVRAIEKVGSQSGQTKKPVKIADCGQLS 150          
BLAST of DC900020 vs. ExPASy Swiss-Prot
Match: CP18C_ARATH (Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Arabidopsis thaliana GN=CYP18-3 PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.014e-32
Identity = 65/80 (81.25%), Postives = 70/80 (87.50%), Query Frame = 1
Query:   31 ENXXKKHTGPGILSMANAGPATNGSQXFVCTAKTXWLDGKHXVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 270
            EN  +KHTGPGILSMANAG  TNGSQ F+CT KT WLDGKH VFGQVVEG+DVVKAIEKVGSSSG+  KPVV+ADCGQLS
Sbjct:   93 ENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPTKPVVVADCGQLS 172          
BLAST of DC900020 vs. ExPASy Swiss-Prot
Match: CYPH_SOLLC (Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum GN=CYP PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.630e-32
Identity = 65/79 (82.28%), Postives = 69/79 (87.34%), Query Frame = 1
Query:   31 ENXXKKHTGPGILSMANAGPATNGSQXFVCTAKTXWLDGKHXVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 267
            EN  KKHTGPGILSMANAGP TNGSQ F+CTAKT WL+GKH VFGQVVEGMDV+K  E VGSSSGR +KPVVIADCGQL
Sbjct:   93 ENFVKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL 171          
BLAST of DC900020 vs. ExPASy Swiss-Prot
Match: CP19B_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana GN=CYP19-2 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 7.652e-32
Identity = 63/80 (78.75%), Postives = 70/80 (87.50%), Query Frame = 1
Query:   31 ENXXKKHTGPGILSMANAGPATNGSQXFVCTAKTXWLDGKHXVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 270
            EN  +KHTGPGILSMANAG  TNGSQ F+CT KT WLDGKH VFGQVVEG+DVVKAIEK+GSSSG+  KPVVIADCG++S
Sbjct:   94 ENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSGKPTKPVVIADCGEIS 173          
BLAST of DC900020 vs. ExPASy Swiss-Prot
Match: CP19A_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana GN=CYP19-1 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.305e-31
Identity = 64/80 (80.00%), Postives = 70/80 (87.50%), Query Frame = 1
Query:   31 ENXXKKHTGPGILSMANAGPATNGSQXFVCTAKTXWLDGKHXVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 270
            EN  KKHTGPGILSMANAG  TNGSQ F+CT KT WLDGKH VFGQVVEG++VV+ IEKVGS SGRT+KPVVIADCGQ+S
Sbjct:   94 ENFIKKHTGPGILSMANAGANTNGSQFFICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTSKPVVIADCGQIS 173          
BLAST of DC900020 vs. ExPASy Swiss-Prot
Match: CYPH_LUPLU (Peptidyl-prolyl cis-trans isomerase OS=Lupinus luteus PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 2.462e-30
Identity = 60/80 (75.00%), Postives = 69/80 (86.25%), Query Frame = 1
Query:   31 ENXXKKHTGPGILSMANAGPATNGSQXFVCTAKTXWLDGKHXVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 270
            EN  K+HTGPGILSMANAG  TNGSQ F+CT KT WLDGKH VFG+V+EGM+VV+ IEKVGS SG+T++PV IADCGQLS
Sbjct:   93 ENFIKRHTGPGILSMANAGAGTNGSQFFICTEKTEWLDGKHVVFGKVIEGMNVVRDIEKVGSGSGKTSRPVTIADCGQLS 172          
BLAST of DC900020 vs. ExPASy Swiss-Prot
Match: CP18D_ARATH (Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Arabidopsis thaliana GN=CYP18-4 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.215e-30
Identity = 62/80 (77.50%), Postives = 68/80 (85.00%), Query Frame = 1
Query:   31 ENXXKKHTGPGILSMANAGPATNGSQXFVCTAKTXWLDGKHXVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 270
            EN  KKHTG GILSMAN+GP TNGSQ F+CT KT WLDGKH VFGQVV+G+DVVKAIEKVGS SG+T+K V I DCGQLS
Sbjct:   93 ENFIKKHTGAGILSMANSGPNTNGSQFFICTDKTSWLDGKHVVFGQVVKGLDVVKAIEKVGSDSGKTSKVVTITDCGQLS 172          
BLAST of DC900020 vs. ExPASy Swiss-Prot
Match: CYPH_BRANA (Peptidyl-prolyl cis-trans isomerase OS=Brassica napus GN=CYP PE=2 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 9.354e-30
Identity = 62/79 (78.48%), Postives = 65/79 (82.28%), Query Frame = 1
Query:   31 ENXXKKHTGPGILSMANAGPATNGSQXFVCTAKTXWLDGKHXVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 267
            EN  KKHTGPGILSM NAG  TNGSQ F+CT KT WLDGKH VFGQVVEGMDVV+ IEKVGS SGRT+K VV  DCGQL
Sbjct:   93 ENFVKKHTGPGILSMRNAGSNTNGSQFFICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTSKKVVTCDCGQL 171          
BLAST of DC900020 vs. ExPASy Swiss-Prot
Match: PPIF_HUMAN (Peptidyl-prolyl cis-trans isomerase, mitochondrial OS=Homo sapiens GN=PPIF PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.555e-29
Identity = 60/82 (73.17%), Postives = 64/82 (78.05%), Query Frame = 1
Query:   25 PYENXXKKHTGPGILSMANAGPATNGSQXFVCTAKTXWLDGKHXVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 270
            P EN   KH GPG+LSMANAGP TNGSQ F+CT KT WLDGKH VFG V EGMDVVK IE  GS SGRT+K +VI DCGQLS
Sbjct:  126 PDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS 207          
The following BLAST results are available for this feature:
BLAST of DC900020 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 170
Match NameE-valueIdentityDescription
CYPH_CATRO8.176e-3486.25Peptidyl-prolyl cis-trans isomerase OS=Catharanthu... [more]
CYPH_ALLCE3.107e-3382.50Peptidyl-prolyl cis-trans isomerase OS=Allium cepa... [more]
CP18C_ARATH2.014e-3281.25Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Ara... [more]
CYPH_SOLLC2.630e-3282.28Peptidyl-prolyl cis-trans isomerase OS=Solanum lyc... [more]
CP19B_ARATH7.652e-3278.75Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Ara... [more]
CP19A_ARATH1.305e-3180.00Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Ara... [more]
CYPH_LUPLU2.462e-3075.00Peptidyl-prolyl cis-trans isomerase OS=Lupinus lut... [more]
CP18D_ARATH3.215e-3077.50Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Ara... [more]
CYPH_BRANA9.354e-3078.48Peptidyl-prolyl cis-trans isomerase OS=Brassica na... [more]
PPIF_HUMAN3.555e-2973.17Peptidyl-prolyl cis-trans isomerase, mitochondrial... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900020 VSS Citrus sinensis cDNA clone VS27Q29 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900020 ID=DC900020|Name=DC900020|organism=Citrus sinensis|type=EST|length=512bp
AATCAATCTACGGCTCAAAATTCGCCGTATGAGAACTTNNNGAAGAAGCA
CACCGGCCCCGGAATCCTNTCCATGGCGAATGCCGGACCCGCAACCAACG
GATCTCAGNTCTTCGTNTGTACGGCCAAGACCGANTGGCTCGATGGGAAG
CACNTTGTGTTCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCAT
CGAGAAAGTGGGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCG
CTGATTGCGGTCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCA
TCACGAGCCGTCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATT
ATGTGGCCGTGTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTAT
GTTACTTGTTCGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACT
GTTTTTTATGTCTTTCTATGAGCTGCCTTTTTAAATAAGATAGGGCTTGT
CTTGGTATATTT
back to top