DC900019

Overview
NameDC900019
Unique NameDC900019
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length565
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7157 contig Csv1_Contig7157:244..808. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900019 vs. ExPASy Swiss-Prot
Match: ARF2_ORYSJ (ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2)

HSP 1 Score: 327.405 bits (838), Expect = 2.980e-89
Identity = 160/161 (99.38%), Postives = 161/161 (100.00%), Query Frame = 1
Query:    1 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 483
            LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 181          
BLAST of DC900019 vs. ExPASy Swiss-Prot
Match: ARF1_ARATH (ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2)

HSP 1 Score: 327.02 bits (837), Expect = 3.893e-89
Identity = 160/161 (99.38%), Postives = 161/161 (100.00%), Query Frame = 1
Query:    1 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 483
            LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA 181          
BLAST of DC900019 vs. ExPASy Swiss-Prot
Match: ARF2_ARATH (ADP-ribosylation factor 2 OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=3)

HSP 1 Score: 326.635 bits (836), Expect = 5.084e-89
Identity = 160/161 (99.38%), Postives = 160/161 (99.38%), Query Frame = 1
Query:    1 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 483
            LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA 181          
BLAST of DC900019 vs. ExPASy Swiss-Prot
Match: ARF_VIGUN (ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3)

HSP 1 Score: 325.479 bits (833), Expect = 1.133e-88
Identity = 159/161 (98.76%), Postives = 161/161 (100.00%), Query Frame = 1
Query:    1 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 483
            LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIA+KA
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA 181          
BLAST of DC900019 vs. ExPASy Swiss-Prot
Match: ARF1_ORYSJ (ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3)

HSP 1 Score: 325.479 bits (833), Expect = 1.133e-88
Identity = 159/161 (98.76%), Postives = 161/161 (100.00%), Query Frame = 1
Query:    1 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 483
            LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA 181          
BLAST of DC900019 vs. ExPASy Swiss-Prot
Match: ARF1_CHLRE (ADP-ribosylation factor 1 OS=Chlamydomonas reinhardtii GN=ARF1 PE=2 SV=2)

HSP 1 Score: 325.094 bits (832), Expect = 1.479e-88
Identity = 158/160 (98.75%), Postives = 160/160 (100.00%), Query Frame = 1
Query:    1 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 480
            LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN+ANK
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNLANK 180          
BLAST of DC900019 vs. ExPASy Swiss-Prot
Match: ARF1_DAUCA (ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2)

HSP 1 Score: 323.553 bits (828), Expect = 4.304e-88
Identity = 158/161 (98.14%), Postives = 160/161 (99.38%), Query Frame = 1
Query:    1 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 483
            LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEI DKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K+
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEIIDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKS 181          
BLAST of DC900019 vs. ExPASy Swiss-Prot
Match: ARF1_SALBA (ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3)

HSP 1 Score: 323.168 bits (827), Expect = 5.621e-88
Identity = 158/161 (98.14%), Postives = 160/161 (99.38%), Query Frame = 1
Query:    1 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 483
            LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI++KA
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSKA 181          
BLAST of DC900019 vs. ExPASy Swiss-Prot
Match: ARF1_CATRO (ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3)

HSP 1 Score: 320.087 bits (819), Expect = 4.758e-87
Identity = 157/161 (97.52%), Postives = 159/161 (98.76%), Query Frame = 1
Query:    1 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 483
            LMVGLDAAGKTTILY+LKLGEIVTTIPTIGFNVETVEY+ ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDK GLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct:   21 LMVGLDAAGKTTILYQLKLGEIVTTIPTIGFNVETVEYQYISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKHGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 181          
BLAST of DC900019 vs. ExPASy Swiss-Prot
Match: ARF_MAIZE (ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2)

HSP 1 Score: 319.701 bits (818), Expect = 6.215e-87
Identity = 156/161 (96.89%), Postives = 160/161 (99.38%), Query Frame = 1
Query:    1 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 483
            LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGL+SLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA K+
Sbjct:   21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLNSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATKS 181          
The following BLAST results are available for this feature:
BLAST of DC900019 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 216
Match NameE-valueIdentityDescription
ARF2_ORYSJ2.980e-8999.38ADP-ribosylation factor 2 OS=Oryza sativa subsp. j... [more]
ARF1_ARATH3.893e-8999.38ADP-ribosylation factor 1 OS=Arabidopsis thaliana ... [more]
ARF2_ARATH5.084e-8999.38ADP-ribosylation factor 2 OS=Arabidopsis thaliana ... [more]
ARF_VIGUN1.133e-8898.76ADP-ribosylation factor OS=Vigna unguiculata GN=AR... [more]
ARF1_ORYSJ1.133e-8898.76ADP-ribosylation factor 1 OS=Oryza sativa subsp. j... [more]
ARF1_CHLRE1.479e-8898.75ADP-ribosylation factor 1 OS=Chlamydomonas reinhar... [more]
ARF1_DAUCA4.304e-8898.14ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1... [more]
ARF1_SALBA5.621e-8898.14ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 P... [more]
ARF1_CATRO4.758e-8797.52ADP-ribosylation factor 1 OS=Catharanthus roseus G... [more]
ARF_MAIZE6.215e-8796.89ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900019 VSS Citrus sinensis cDNA clone VS27Q28 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900019 ID=DC900019|Name=DC900019|organism=Citrus sinensis|type=EST|length=565bp
CTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGCT
TAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTAG
AGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGGT
CAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAGG
ACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCTA
GGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGTG
CTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTGC
TGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGGT
ATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACTT
GACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTTG
AGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTNACAACACATCTCAA
GGTGTTCTTGCTTTC
back to top