DC900018

Overview
NameDC900018
Unique NameDC900018
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length659
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4110 contig Csv1_Contig4110:19..677. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900018 vs. ExPASy Swiss-Prot
Match: TRXL4_ARATH (Thioredoxin-like 4 OS=Arabidopsis thaliana GN=At1g11530 PE=2 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 6.935e-33
Identity = 67/113 (59.29%), Postives = 81/113 (71.68%), Query Frame = 3
Query:   84 SRVVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXXXXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRIDSFVQSIRV 422
            +RVVK+DS ESW  +VSQA NQ CP+V HFTA+WC+PSV MN  FEELA  Y                AS+LEVKAMPTFL +++G  +DKLVGANP+EI+KR+D FVQS RV
Sbjct:    2 ARVVKIDSAESWNFYVSQAKNQNCPIVAHFTALWCIPSVFMNSFFEELAFNYKDALFLIVDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEIKKRVDGFVQSSRV 114          
BLAST of DC900018 vs. ExPASy Swiss-Prot
Match: TRXH_WHEAT (Thioredoxin H-type OS=Triticum aestivum PE=1 SV=3)

HSP 1 Score: 76.2554 bits (186), Expect = 1.606e-13
Identity = 39/102 (38.24%), Postives = 55/102 (53.92%), Query Frame = 3
Query:   90 VVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXXXXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRI 395
            V+ V S+E W   + +AN     VV+ FTA WC P   M P+F +LA  +P               A +  V+AMPTFL M+EG V D++VGA  EE+  ++
Sbjct:   20 VISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTTKV 121          
BLAST of DC900018 vs. ExPASy Swiss-Prot
Match: TRXH_POPJC (Thioredoxin H-type OS=Populus jackii PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.971e-13
Identity = 36/106 (33.96%), Postives = 58/106 (54.72%), Query Frame = 3
Query:   99 VDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXXXXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRIDSFVQSI 416
            + + E W+  +S+A+  G  V+ +F+A WC P   + P + EL+  YP               ++  E+KA PTF  +R+G  VDKLVGAN  E+ K+I + + S+
Sbjct:   29 ITTKERWDQKLSEASRDGKIVLANFSARWCGPCKQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAILDSL 134          
BLAST of DC900018 vs. ExPASy Swiss-Prot
Match: TRXH1_ARATH (Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.319e-12
Identity = 36/105 (34.29%), Postives = 56/105 (53.33%), Query Frame = 3
Query:   81 KSRVVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXXXXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRI 395
            + +V+   +VE+W   + +AN     VVV FTA WC P   + P F +LA   P               AS   ++AMPTF+ ++EG ++DK+VGA  +E++  I
Sbjct:    5 EGQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTI 109          
BLAST of DC900018 vs. ExPASy Swiss-Prot
Match: TRXH9_ARATH (Thioredoxin H-type 9 OS=Arabidopsis thaliana GN=TRX9 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.956e-12
Identity = 36/125 (28.80%), Postives = 64/125 (51.20%), Query Frame = 3
Query:   42 KKDMEAAAQEQQNKSRVVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXXXXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRIDSFVQSI 416
            K D ++    + +   V  + + ESW+  +++A+  G  VV +F+A WC P   + P F EL+  +                +S  ++KA PTF  ++ G  + KLVGAN  E++K++ S + S+
Sbjct:    9 KGDDDSVHNVEFSGGNVHLITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKNGQQIGKLVGANKPELQKKVTSIIDSV 133          
BLAST of DC900018 vs. ExPASy Swiss-Prot
Match: TRXH5_ARATH (Thioredoxin H-type 5 OS=Arabidopsis thaliana GN=TRX5 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.151e-11
Identity = 33/105 (31.43%), Postives = 56/105 (53.33%), Query Frame = 3
Query:   81 KSRVVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXXXXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRI 395
            +  V+   ++E W   V  AN     +V+ FTA WC P   + P+F E+A  +                A + +V+AMPTF+ M+EG ++D++VGA  +EI +++
Sbjct:    4 EGEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKL 108          
BLAST of DC900018 vs. ExPASy Swiss-Prot
Match: TRXH_PICMA (Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.713e-11
Identity = 32/105 (30.48%), Postives = 55/105 (52.38%), Query Frame = 3
Query:   81 KSRVVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXXXXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRI 395
            +  V    S E W + + +A +    V V FTA WC P   + P+F EL+  +P               A + +V+AMPTF+ +++G  VDK+VGA  +++ +++
Sbjct:    3 EGNVFACHSTEGWRSKLQEAIDTKRLVAVDFTATWCGPCRVIGPVFVELSKKFPEIFFLKVDVDELRDVAQEWDVEAMPTFIFIKDGKAVDKVVGAKKDDLERKV 107          
BLAST of DC900018 vs. ExPASy Swiss-Prot
Match: TRXH_FAGES (Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.713e-11
Identity = 31/105 (29.52%), Postives = 57/105 (54.29%), Query Frame = 3
Query:   81 KSRVVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXXXXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRI 395
            +++V+   +V+ W     +A + G  +V+ FTA WC P   + P   ELA  +P               A + +V+AMP+F++++EG  V+++VGA  +E+  +I
Sbjct:    4 EAQVIACHTVQEWNEKFQKAKDSGKLIVIDFTASWCGPCRVITPYVSELAKKFPHVAFFKVDVDDLKDVAEEYKVEAMPSFVILKEGQEVERIVGARKDELLHKI 108          
BLAST of DC900018 vs. ExPASy Swiss-Prot
Match: TRXH2_TOBAC (Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.461e-11
Identity = 34/111 (30.63%), Postives = 58/111 (52.25%), Query Frame = 3
Query:   81 KSRVVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXXXXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRIDSFVQS 413
            + +V+ V +V++W   + +  +    +VV FTA WC P   +   + ELA   P               A+   V+AMPTF+ ++EG +VDK+VGA  +E+++ I   + S
Sbjct:    4 EGQVIGVHTVDAWNEHLQKGIDDKKLIVVDFTASWCGPCKFIASFYAELAKKMPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHISS 114          
BLAST of DC900018 vs. ExPASy Swiss-Prot
Match: TRXH_RICCO (Thioredoxin H-type OS=Ricinus communis PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 9.744e-11
Identity = 37/112 (33.04%), Postives = 59/112 (52.68%), Query Frame = 3
Query:   60 AAQEQQNKSRVVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXXXXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRI 395
            AA+E Q    V+   +VE+W   + + N+    +VV FTA WC P   + P   ELA   P               A +  V++MPTF+ ++EG ++DK+VGA  +E+++ I
Sbjct:    2 AAEEGQ----VIGCHTVEAWNEQLQKGNDTKGLIVVDFTASWCGPCRFIAPFLAELAKKLPNVTFLKVDVDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTI 109          
The following BLAST results are available for this feature:
BLAST of DC900018 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
TRXL4_ARATH6.935e-3359.29Thioredoxin-like 4 OS=Arabidopsis thaliana GN=At1g... [more]
TRXH_WHEAT1.606e-1338.24Thioredoxin H-type OS=Triticum aestivum PE=1 SV=3[more]
TRXH_POPJC7.971e-1333.96Thioredoxin H-type OS=Populus jackii PE=1 SV=1[more]
TRXH1_ARATH2.319e-1234.29Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TR... [more]
TRXH9_ARATH3.956e-1228.80Thioredoxin H-type 9 OS=Arabidopsis thaliana GN=TR... [more]
TRXH5_ARATH1.151e-1131.43Thioredoxin H-type 5 OS=Arabidopsis thaliana GN=TR... [more]
TRXH_PICMA5.713e-1130.48Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 S... [more]
TRXH_FAGES5.713e-1129.52Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV... [more]
TRXH2_TOBAC7.461e-1130.63Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=... [more]
TRXH_RICCO9.744e-1133.04Thioredoxin H-type OS=Ricinus communis PE=3 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionDC900018 VSS Citrus sinensis cDNA clone VS27Q27 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900018 ID=DC900018|Name=DC900018|organism=Citrus sinensis|type=EST|length=659bp
CCAATATCTATCTGTCTATTTCCAAACCCTAGAAGAGGAAGAAGAAAGAC
ATGGAAGCAGCGGCACAGGAGCAGCAGAACAAATCGAGAGTTGTGAAAGT
AGATTCAGTTGAATCTTGGGAAACTTTTGTCTCCCAAGCCAACAATCAAG
GCTGCCCTGTAGTTGTACACTTTACTGCTATTTGGTGCATGCCTTCTGTG
GCCATGAATCCATTATTTGAAGAACTGGCCTCAGCGTATCCTGATGTCCT
GTTTCTTTCTGTTGATGTTGACGATGTCAAGGATGTGGCGTCTAAACTGG
AGGTAAAGGCCATGCCAACATTTTTGCTGATGAGGGAAGGGGCTGTAGTC
GACAAGCTAGTGGGTGCCAATCCAGAAGAGATAAGGAAAAGGATTGATAG
TTTTGTTCAATCCATCCGAGTATATGTAGCCTAGTAACATCAGATTGCTC
TGTGGTTTTTGTACATAGCTTGAACCTGTGAAATATGTGGTTGNGCTTCT
TTTTTGCATTAAACAGGTTTGTTAAGTTGTTGGATTCTGGCTTTCAAGTG
TCTCGATTACAATCCGGAATTATGTAATGCNCCNGCTTTTGTTTTGATAT
TTTACCCTACCCTGTTGTATTACATACANTTCCCAATAAATTTATCAAAG
TTGGTTGTG
back to top