DC900015

Overview
NameDC900015
Unique NameDC900015
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10926 contig Csv1_Contig10926:991..1547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 6.270e-36
Identity = 69/111 (62.16%), Postives = 87/111 (78.38%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            KL     LCM+V+ P+ AQAITCGQVS +LAPCI ++R GG +P  CCNG+R++N  ARTTPDRQ ACNCLKQ + S+P +N NNAA LPG CGV+IPY+IS ST+C+ V+
Sbjct:    8 KLALVVALCMVVSVPI-AQAITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 8.189e-36
Identity = 67/111 (60.36%), Postives = 87/111 (78.38%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            KL     LCM+V+ P+ AQA+TCGQVS +LAPCI ++R GG +P  CCNG+R++N  A+TT DRQTACNCLKQ + S+P +N NNAA LPG CGV++PYKIS ST+C+ V+
Sbjct:    8 KLALVVALCMVVSVPI-AQALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 8.189e-36
Identity = 71/111 (63.96%), Postives = 85/111 (76.58%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            KL     LCM V+    A AITCGQV+ SLAPCIG++RSGG +P  CCNG+R++N  ARTT DRQTACNCLK  A SI  +N NNAAGLPG CGV++PYKISTST+C+ V+
Sbjct:    8 KLALVVALCMAVS---VAHAITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.634e-34
Identity = 68/112 (60.71%), Postives = 84/112 (75.00%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            + ++ A V CM+V  P + +A++CGQVS SLAPCI +L  GG +P  CC+GV+SLN+AA+TTPDRQ AC CLK A  SI  +N  NAA  PG CGVSIPYKIS STDCSKV+
Sbjct:    6 MMVLCAGVTCMVVGAPYT-EALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ 116          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 7.665e-34
Identity = 67/91 (73.63%), Postives = 73/91 (80.22%), Query Frame = 1
Query:   64 ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            ITCGQVS SLAPCI +LR+GG +P  CCNGVRSLN AA+TT DRQ ACNCLK A  SI  LNLN AAGLPG CGVS+PYKIS STDC  V+
Sbjct:    1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP2_BRANA (Non-specific lipid-transfer protein 2 OS=Brassica napus GN=LTP2 PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 8.475e-33
Identity = 66/113 (58.41%), Postives = 82/113 (72.57%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +KL    + CM+V GP+++ A ++CG VSG +APCIG+L   GP+P  CC GV +LN  ARTTPDRQ AC CL  AA S P+LN   AAGLP ACGV+IPYKIS ST+C+ VR
Sbjct:    5 MKLACLVLACMIVAGPITSNAALSCGTVSGYVAPCIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUAR (Non-specific lipid-transfer protein 1 OS=Prunus armeniaca PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 8.475e-33
Identity = 62/91 (68.13%), Postives = 75/91 (82.42%), Query Frame = 1
Query:   64 ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            ITCGQVS SLAPCIG++R GG +P  CCNG+R++N  ARTTPDR+TACNCLKQ + SI  +N NNAA LPG CGV+IPYKIS ST+C+ V+
Sbjct:    1 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK 91          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_SPIOL (Non-specific lipid-transfer protein OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 1.446e-32
Identity = 65/111 (58.56%), Postives = 81/111 (72.97%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            +KL  A +LC++V  P +   ITCG VS  LAPCIG+L+ GGP+   CC G+++LNAAA TTPDR+TACNCLK AA +I  +N   AAGLPG CGV IPY IS ST+C+ V
Sbjct:    7 IKLACAVLLCIVVAAPYAEAGITCGMVSSKLAPCIGYLK-GGPLGGGCCGGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAV 116          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_PYRCO (Non-specific lipid-transfer protein OS=Pyrus communis PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.220e-32
Identity = 63/112 (56.25%), Postives = 81/112 (72.32%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +KL     LCM V+    A AITC QVS +LAPCI ++RSGG +P  CCNG++++N  A+TTPDRQ ACNCLK  A S+  +N  NA  LPG CGV++PYKISTST+C+ V+
Sbjct:    7 IKLALVVALCMAVS---VAHAITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTPB_BRAOT (Non-specific lipid-transfer protein B OS=Brassica oleracea var. italica GN=WAX9B PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.206e-32
Identity = 66/113 (58.41%), Postives = 81/113 (71.68%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +KL    + CM+V GP++  A ++CG VSG+LA CIG+L   GP+P  CC GV +LN  ARTTPDRQ AC CL  AA S P+LN   AAGLP ACGV+IPYKIS ST+C+ VR
Sbjct:    5 VKLSCLVLACMIVAGPIATNAALSCGTVSGNLAACIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
The following BLAST results are available for this feature:
BLAST of DC900015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP1_PRUDU6.270e-3662.16Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP_PRUAV8.189e-3660.36Non-specific lipid-transfer protein OS=Prunus aviu... [more]
NLTP_MALDO8.189e-3663.96Non-specific lipid-transfer protein OS=Malus domes... [more]
NLTP_HELAN2.634e-3460.71Non-specific lipid-transfer protein OS=Helianthus ... [more]
LTP1_MORNI7.665e-3473.63Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP2_BRANA8.475e-3358.41Non-specific lipid-transfer protein 2 OS=Brassica ... [more]
NLTP1_PRUAR8.475e-3368.13Non-specific lipid-transfer protein 1 OS=Prunus ar... [more]
NLTP_SPIOL1.446e-3258.56Non-specific lipid-transfer protein OS=Spinacia ol... [more]
NLTP_PYRCO3.220e-3256.25Non-specific lipid-transfer protein OS=Pyrus commu... [more]
NLTPB_BRAOT4.206e-3258.41Non-specific lipid-transfer protein B OS=Brassica ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900015 VSS Citrus sinensis cDNA clone VS27Q25 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900015 ID=DC900015|Name=DC900015|organism=Citrus sinensis|type=EST|length=557bp
CTCAAGCTTGTTTCAGCTTGGGTTCTGTGCATGTTGGTGACTGGTCCCCT
GAGTGCTCAGGCCATAACATGTGGGCAGGTGAGTGGCTCATTGGCACCAT
GCATCGGTTTCTTGAGATCGGGCGGCCCTATACCTATGCCATGCTGCAAC
GGCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAAC
TGCATGCAACTGCTTGAAGCAAGCCGCCAGATCAATCCCTAGCCTCAACC
TTAATAATGCTGCTGGTCTTCCAGGAGCTTGTGGAGTCAGCATTCCTTAC
AAGATCAGCACCTCCACTGACTGCTCTAAGGTCAGGTGAACAGGAATCTG
GGCCGTTGATTTTCAGGTTTAAGTTGACGGAGTAGAATAAATGTATAATA
ATAAGGACATTTTTGTGTCCGATTTATGAGTCTCTCTCTACACTTTGTAC
TGCGAGTCTCGTTCGCGCCCTCGTTTCATGTTATGTTTTATTGGCTTTGC
TTTTCATGTCATCGGCAGNTTGGGTCTATTCTGGTTAATTAAATGAAATC
TTGCCTT
back to top