DC900012

Overview
NameDC900012
Unique NameDC900012
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length872
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2213 contig Csv1_Contig2213:433..1305. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL57_ARATH (GDSL esterase/lipase At3g48460 OS=Arabidopsis thaliana GN=At3g48460 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.778e-82
Identity = 98/156 (62.82%), Postives = 123/156 (78.85%), Query Frame = 2
Query:    2 DITPQSIQTQLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNAF 469
            D+TPQSI+T+L WF K+LE+ G  +  S        F D+LFW+GEIGVNDYAYTLGS+V+SDTIR+L+I +FT FL+ LL +G KY++VQG P TGCL LAM LA EDDRD +GCV+S NNQSYTHNL LQ++L+ LR ++P A IVYADYWNA+
Sbjct:  144 DMTPQSIETELAWFEKYLETLGTNQKVS-------LFKDSLFWIGEIGVNDYAYTLGSTVSSDTIRELSISTFTRFLETLLNKGVKYMLVQGHPATGCLTLAMSLAAEDDRDSLGCVQSANNQSYTHNLALQSKLKQLRIKYPSATIVYADYWNAY 292          

HSP 2 Score: 118.627 bits (296), Expect = 4.778e-82
Identity = 56/82 (68.29%), Postives = 62/82 (75.61%), Query Frame = 1
Query:  484 KIQGKYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSYLLSRK 729
            K   KYG  E FKACCG GEP YNF VF TCG+ +A  C +P QYINWDGVHL EAMYKVM+DMFL GTF+RP FS LL +K
Sbjct:  297 KHPSKYGITEKFKACCGIGEP-YNFQVFQTCGTDAATVCKDPNQYINWDGVHLTEAMYKVMADMFLDGTFTRPRFSDLLIKK 377          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL91_ARATH (GDSL esterase/lipase At1g28640 OS=Arabidopsis thaliana GN=At1g28640 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.197e-30
Identity = 35/77 (45.45%), Postives = 46/77 (59.74%), Query Frame = 1
Query:  496 KYGFKE-PFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSYLLS 723
            KYGFK  P  ACCG G   YNF +   CG      C NP +Y+NWDG HL EA ++ M+ + L+GT++ P F +  S
Sbjct:  302 KYGFKNRPLAACCGVGGQ-YNFTIGKECGHRGVSCCQNPSEYVNWDGYHLTEATHQKMAQVILNGTYASPAFDWSCS 377          

HSP 2 Score: 74.7146 bits (182), Expect = 5.197e-30
Identity = 51/162 (31.48%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    2 DITPQSIQTQLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLA---IPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYL---APEDDRDGI-GCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            D T  S+  QL  F + L +       SS   C+    D+L  +GEIGVNDY Y      + + I++L    I + ++ +  L+  G K  +V G    GC P  + L   A E+D D   GC+  +N     HN  L+ +L+ L++ +    I+YADY+N+
Sbjct:  135 DFTNVSLSVQLNIFKQILPNL----CTSSSRDCREMLGDSLILMGEIGVNDYNYPFFEGKSINEIKQLVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCYPAYLTLFQTAAEEDHDPFTGCIPRLNEFGEYHNEQLKTELKRLQELYDHVNIIYADYYNS 292          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL40_ARATH (GDSL esterase/lipase At2g27360 OS=Arabidopsis thaliana GN=At2g27360 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.233e-28
Identity = 33/74 (44.59%), Postives = 48/74 (64.86%), Query Frame = 1
Query:  496 KYGFKE-PFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSY 714
            K+G  + P  ACCG G P YNF     CGS   + C +P +Y+NWDG+H+ EA YK +S+  L+G ++ PPF++
Sbjct:  300 KFGLMDRPLPACCGLGGP-YNFTFSIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIPPFNW 372          

HSP 2 Score: 71.633 bits (174), Expect = 1.233e-28
Identity = 44/134 (32.84%), Postives = 70/134 (52.24%), Query Frame = 2
Query:   83 SSGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLA---IPSFTNFLQALLKRGAKYVVVQGLPTTGCLP--LAMYLAP--EDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            SS P C+   ++A   +GEIG NDY + L      + +++L    I + ++ +  L+  GA+  +V G    GC    L +Y  P  E+     GC+  +N+ S  HN  LQA+L+ LR  +P   I+Y DY+N
Sbjct:  156 SSSPDCRDMIENAFILIGEIGGNDYNFPLFDRKNIEEVKELVPLVITTISSAISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYNPLTGCLTWLNDFSVYHNEQLQAELKRLRNLYPHVNIIYGDYYN 289          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL9_ARATH (GDSL esterase/lipase At1g28600 OS=Arabidopsis thaliana GN=At1g28600 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.090e-28
Identity = 39/76 (51.32%), Postives = 50/76 (65.79%), Query Frame = 1
Query:  484 KIQGKYGFKE-PFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPF 708
            K   K+GF E PF ACCG G P YNFN    CGS   K+C +P +Y+ WDGVH+ EA YK ++D  L+G ++ PPF
Sbjct:  292 KEPAKFGFMERPFPACCGIGGP-YNFNFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPF 366          

HSP 2 Score: 61.2326 bits (147), Expect = 2.090e-28
Identity = 47/160 (29.38%), Postives = 75/160 (46.88%), Query Frame = 2
Query:    8 TPQSIQTQLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLA---IPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRD----GIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            T  S+  QL  F K L +  C     S   C+    +AL  +GEIG NDY +   +      + +L    I S ++ +  L+  G K  +V G    GC  + + L    ++D      GC+K +N     H+  L+ +L  LR+ +P   I+YADY+N+
Sbjct:  132 TNVSLGVQLKSFKKSLPNL-C----GSPSDCRDMIGNALILMGEIGGNDYNFPFFNRKPVKEVEELVPFVIASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDEYDPSTGCLKWLNKFGEYHSEKLKVELNRLRKLYPHVNIIYADYYNS 286          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL13_ARATH (GDSL esterase/lipase At1g28670 OS=Arabidopsis thaliana GN=At1g28670 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.725e-27
Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  496 KYGFK-EPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSY 714
            KYGFK +P  ACCG G   YNF +   CG      C NP +Y+NWDG HL EA Y+ M++  L+G ++ P F +
Sbjct:  302 KYGFKNKPLAACCGVGGK-YNFTIGKECGYEGVNYCQNPSEYVNWDGYHLTEAAYQKMTEGILNGPYATPAFDW 374          

HSP 2 Score: 68.1662 bits (165), Expect = 1.725e-27
Identity = 49/162 (30.25%), Postives = 77/162 (47.53%), Query Frame = 2
Query:    2 DITPQSIQTQLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLA---IPSFTNFLQALLKRGAKYVVVQGLPTTGC----LPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            D T  S+  QL  F + L +       SS   C+    D+L  +GEIG NDY Y      + + I++L    + + ++ +  L+  G K  +V G   TGC    L L   +A +D     GC   +N     HN  L+ +L+ L++ +P   I+YADY N+
Sbjct:  135 DFTNVSLSVQLDTFKQILPNL----CASSTRDCKEMLGDSLILMGEIGGNDYNYPFFEGKSINEIKELVPLIVKAISSAIVDLIDLGGKTFLVPGGFPTGCSAAYLTLFQTVAEKDQDPLTGCYPLLNEFGEHHNEQLKTELKRLQKFYPHVNIIYADYHNS 292          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL12_ARATH (GDSL esterase/lipase At1g28660 OS=Arabidopsis thaliana GN=At1g28660 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.924e-27
Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  496 KYGFK-EPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSY 714
            KYGFK +P  ACCG G   YNF +   CG      C NP +Y+NWDG HL EA Y+ M++  L+G ++ P F +
Sbjct:  301 KYGFKNKPLAACCGVGGK-YNFTIGKECGYEGVSYCQNPSEYVNWDGYHLTEAAYQKMAEGILNGPYATPAFDW 373          

HSP 2 Score: 67.3958 bits (163), Expect = 2.924e-27
Identity = 50/161 (31.06%), Postives = 79/161 (49.07%), Query Frame = 2
Query:    2 DITPQSIQTQLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAY--TLGSSVTSDTIRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLP--LAMYL-APEDDRDGI-GCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            D T  S+  QL  F + L +       SS   C+    D+L  +GEIG ND+ Y  + G S+    ++ L I + ++ +  L+  G K  +V G    GC    L  Y  A E+D D + GC+  +N      N  L+ +L+ L++ +P   I+YADY N+
Sbjct:  135 DFTNVSLGVQLDIFKQILPNL----CASSSRDCREMLGDSLILMGEIGGNDFFYPSSEGKSINETKLQDLIIKAISSAIVDLIALGGKTFLVPGGFPAGCSAACLTQYQNATEEDYDPLTGCIPRLNELGEHDNEQLKTELKRLQKLYPDVNIIYADYHNS 291          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL83_ARATH (GDSL esterase/lipase At5g45910 OS=Arabidopsis thaliana GN=At5g45910 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.423e-26
Identity = 54/163 (33.13%), Postives = 81/163 (49.69%), Query Frame = 2
Query:    5 ITPQSIQTQLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAYTL---GSSVTSDTIRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGI------GCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            +T +++  QL WF K L+   CK    + P+C+  F  +LF VGEIG NDY Y L    S   +  +    I    +   AL++ GA  ++V G    GC   A  L   +D  G        C   +NN +  HN  L+  L  LR+++P A I+YADY+++
Sbjct:  135 LTNKTLDIQLDWFKK-LKPSLCK----TKPECEQYFRKSLFLVGEIGGNDYNYPLLAFRSFKHAMDLVPFVINKIMDVTSALIEEGAMTLIVPGNLPIGCS--AALLERFNDNSGWLYDSRNQCYMPLNNLAKLHNDKLKKGLAALRKKYPYAKIIYADYYSS 290          

HSP 2 Score: 68.9366 bits (167), Expect = 1.423e-26
Identity = 30/73 (41.10%), Postives = 41/73 (56.16%), Query Frame = 1
Query:  496 KYGFK-EPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFS 711
            KYGF     KACCG G+  YN      CG   +  C +P  Y NWDG+HL EA Y+ ++   +SG F+ P ++
Sbjct:  300 KYGFTGSVLKACCGGGDGRYNVQPNVRCGEKGSTTCEDPSTYANWDGIHLTEAAYRHIATGLISGRFTMPTYN 372          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL11_ARATH (GDSL esterase/lipase At1g28650 OS=Arabidopsis thaliana GN=At1g28650 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.137e-26
Identity = 34/74 (45.95%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  496 KYGFKE-PFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSY 714
            KYGFK  P  ACCG G   YNF +   CG      C NP +Y+NWDG HL EA Y+ M+   L+G ++ P F +
Sbjct:  303 KYGFKNRPLAACCGVGGQ-YNFTIGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLNGRYTTPAFDW 375          

HSP 2 Score: 64.6994 bits (156), Expect = 3.137e-26
Identity = 47/161 (29.19%), Postives = 77/161 (47.83%), Query Frame = 2
Query:    2 DITPQSIQTQLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLA---IPSFTNFLQALLKRGAKYVVVQGLPTTGCLP--LAMYLAPEDDRDGI-GCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            D T  S+  QL  F + L +       SS   C+    D+L  +GEIG NDY Y      + + I++L    I + ++ +  L+  G K  +V G    GC    L ++     + D   GC+  +N     HN  L+ +L+ L++ +P   I+YADY+N+
Sbjct:  137 DFTNISLSVQLNTFKQILPNL----CASSTRDCREMLGDSLILMGEIGGNDYNYPFFEGKSINEIKELVPLIIKAISSAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTATVEHDPFTGCIPWLNKFGEHHNEQLKIELKQLQKLYPHVNIIYADYYNS 293          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL7_ARATH (GDSL esterase/lipase At1g28580 OS=Arabidopsis thaliana GN=At1g28580 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.082e-26
Identity = 32/74 (43.24%), Postives = 50/74 (67.57%), Query Frame = 1
Query:  496 KYGF-KEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSY 714
            K+GF   P  ACCG+G P YN+ V   CG+   ++C +P +Y+ WDGVH+ EA Y++M++  L+G ++ PPF +
Sbjct:  303 KFGFMNRPLSACCGAGGP-YNYTVGRKCGTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAIPPFDW 375          

HSP 2 Score: 62.003 bits (149), Expect = 4.082e-26
Identity = 41/137 (29.93%), Postives = 69/137 (50.36%), Query Frame = 2
Query:   86 SGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKL---AIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAM---YLAPEDDRDGI-GCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNAFPH 475
            S   C+   ++AL  +GEIG NDY Y        + I++L    I + ++ +  L+  G +  +V G    GC  L +     +  ++ D + GC+K +N     H   L+A+L  L++ +P   I+YADY+NA  H
Sbjct:  160 SPSDCRDMIENALILMGEIGGNDYNYAFFVDKGIEEIKELMPLVITTISSAITELIGMGGRTFLVPGEFPVGCSVLYLTSHQTSNMEEYDPLTGCLKWLNKFGENHGEQLRAELNRLQKLYPHVNIIYADYYNALFH 296          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL16_ARATH (GDSL esterase/lipase At1g31550 OS=Arabidopsis thaliana GN=At1g31550 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.643e-25
Identity = 34/74 (45.95%), Postives = 48/74 (64.86%), Query Frame = 1
Query:  496 KYGF-KEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSY 714
            KYGF      ACCG G P YNFN+  +CGS   +AC +P +Y+ WDG+H+ EA +K M+D  + G ++ PPF +
Sbjct:  301 KYGFINRHLSACCGVGGP-YNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDW 373          

HSP 2 Score: 57.3806 bits (137), Expect = 9.643e-25
Identity = 40/130 (30.77%), Postives = 62/130 (47.69%), Query Frame = 2
Query:   98 CQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLA---IPSFTNFLQALLKRGAKYVVVQGLPTTGC----LPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            C+    +AL  +GEIG NDY +        D +++L    I + ++ +  L+  G +  +V G    GC    L L      E+     GC+K +N     H+  LQ +L  LR+  P   I+YADY+NA
Sbjct:  162 CRDMIGNALILMGEIGANDYNFPFFQLRPLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNA 291          
The following BLAST results are available for this feature:
BLAST of DC900012 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
GDL57_ARATH4.778e-8262.82GDSL esterase/lipase At3g48460 OS=Arabidopsis thal... [more]
GDL91_ARATH5.197e-3045.45GDSL esterase/lipase At1g28640 OS=Arabidopsis thal... [more]
GDL40_ARATH1.233e-2844.59GDSL esterase/lipase At2g27360 OS=Arabidopsis thal... [more]
GDL9_ARATH2.090e-2851.32GDSL esterase/lipase At1g28600 OS=Arabidopsis thal... [more]
GDL13_ARATH1.725e-2745.95GDSL esterase/lipase At1g28670 OS=Arabidopsis thal... [more]
GDL12_ARATH2.924e-2745.95GDSL esterase/lipase At1g28660 OS=Arabidopsis thal... [more]
GDL83_ARATH1.423e-2633.13GDSL esterase/lipase At5g45910 OS=Arabidopsis thal... [more]
GDL11_ARATH3.137e-2645.95GDSL esterase/lipase At1g28650 OS=Arabidopsis thal... [more]
GDL7_ARATH4.082e-2643.24GDSL esterase/lipase At1g28580 OS=Arabidopsis thal... [more]
GDL16_ARATH9.643e-2545.95GDSL esterase/lipase At1g31550 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900012 VSS Citrus sinensis cDNA clone VS27Q23 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900012 ID=DC900012|Name=DC900012|organism=Citrus sinensis|type=EST|length=872bp
TGACATTACTCCTCAGTCAATCCAAACTCAGCTCATTTGGTTCAACAAGT
TCTTGGAGAGCAAGGGATGTAAAGAAGCAGAGTCCTCAGGGCCTCAGTGC
CAGGCAGCTTTCGATGATGCATTGTTCTGGGTTGGTGAAATTGGAGTCAA
CGATTATGCGTACACTCTAGGATCTTCTGTTACAAGTGACACTATCCGAA
AACTCGCTATCCCTAGTTTTACAAATTTTCTGCAGGCGTTGCTTAAAAGA
GGAGCAAAATATGTTGTTGTTCAAGGTCTGCCGACAACAGGATGCTTGCC
GCTGGCAATGTATTTGGCCCCTGAAGACGATAGAGACGGTATAGGCTGTG
TAAAAAGTGTGAACAATCAAAGCTACACCCATAACCTTGTTCTTCAAGCC
CAATTACAGAATCTTAGACAGCAGTTTCCCCAGGCTGTGATTGTATATGC
TGATTACTGGAATGCTTTCCCGCATGGTGATGAAAAATCCAGGGGAAGTA
CGGGTTCAAGGAGCCCTTCAAGGCTTGCTGCGGATCCGGTGAACCTCCTT
ACAACTTTAATGTGTTTGCTACTTGTGGCTCGCCCTCTGCAAAAGCTTGC
CCGAATCCTTATCAATACATCAACTGGGACGGAGTTCATCTCNCTGAAGC
CATGTATAAGGTGATGAGTGACATGTTTCTTAGCGGAACATTTAGTCGCC
CTCCGTTCAGCTACTTACTGAGCAGAAAGCAGCGGGACGGATGAACCTCT
TGGTTATTGAAATTGGCTAANCAATANCAATGATTGTCTTTGAGCTCTGT
ATTATTATTTTTTTTTTCCNCTTTTCAAATATGGAGCCGTTAATCAACGG
TTTAAAATTTCCAGTGAACTTG
back to top