DC900011

Overview
NameDC900011
Unique NameDC900011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: BRI1_ARATH (Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 1.171e-95
Identity = 175/204 (85.78%), Postives = 186/204 (91.18%), Query Frame = 2
Query:  107 SARGI--------PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTI-ATDEGGFGTVEMVEMSIQEAPE 691
            SARG+        PHIIHRDMKSSNVLLDEN EARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDS DFGDNNLVGWVKQHAKL+ISDVFDPELMKEDP +EIELLQHL VA ACLDDR WRRPTM+QVMAMFKEIQAGSG+DSQSTI + ++GGF T+EMV+MSI+E PE
Sbjct:  990 SARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSPDFGDNNLVGWVKQHAKLRISDVFDPELMKEDPALEIELLQHLKVAVACLDDRAWRRPTMVQVMAMFKEIQAGSGIDSQSTIRSIEDGGFSTIEMVDMSIKEVPE 1193          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: BRI1_SOLPE (Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.460e-87
Identity = 165/198 (83.33%), Postives = 175/198 (88.38%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGF----GTVEM-VEMSIQEAPELS 697
            IPHIIHRDMKSSNVLLDEN EARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGK+PTDSADFGDNNLVGWVK HAK KI+DVFD EL+KED +IEIELLQHL VA ACLDDR W+RPTMIQVMAMFKEIQAGSG+DS STI  D+  F    G +EM +  SI+E  ELS
Sbjct: 1007 IPHIIHRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKQPTDSADFGDNNLVGWVKLHAKGKITDVFDRELLKEDASIEIELLQHLKVACACLDDRHWKRPTMIQVMAMFKEIQAGSGMDSTSTIGADDVNFSGVEGGIEMGINGSIKEGNELS 1204          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: BRI1_SOLLC (Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.460e-87
Identity = 165/198 (83.33%), Postives = 175/198 (88.38%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGF----GTVEM-VEMSIQEAPELS 697
            IPHIIHRDMKSSNVLLDEN EARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGK+PTDSADFGDNNLVGWVK HAK KI+DVFD EL+KED +IEIELLQHL VA ACLDDR W+RPTMIQVMAMFKEIQAGSG+DS STI  D+  F    G +EM +  SI+E  ELS
Sbjct: 1007 IPHIIHRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKQPTDSADFGDNNLVGWVKLHAKGKITDVFDRELLKEDASIEIELLQHLKVACACLDDRHWKRPTMIQVMAMFKEIQAGSGMDSTSTIGADDVNFSGVEGGIEMGINGSIKEGNELS 1204          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: BRL1_ARATH (Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.182e-63
Identity = 124/192 (64.58%), Postives = 154/192 (80.21%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFG-DNNLVGWVKQ-HAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFGTVEMVEMSIQEAP 688
            IPHIIHRDMKSSNVLLDE+FEARVSDFGMARL+SA+DTHLSVSTLAGTPGYVPPEYYQSFRC+ KGDVYSYGV+LLELL+GK+P D  +FG DNNLVGW KQ + + + +++ DPEL+  D + ++EL  +L +AS CLDDRP++RPTMIQ+MAMFKE++A    D++   + DE       +VE S  + P
Sbjct:  980 IPHIIHRDMKSSNVLLDEDFEARVSDFGMARLVSALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPGEFGEDNNLVGWAKQLYREKRGAEILDPELV-TDKSGDVELFHYLKIASQCLDDRPFKRPTMIQLMAMFKEMKA----DTEEDESLDEFSLKETPLVEESRDKEP 1166          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: BRL3_ARATH (Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 5.490e-61
Identity = 115/159 (72.33%), Postives = 139/159 (87.42%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFG-DNNLVGWVKQ-HAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEI 589
            IPHIIHRDMKSSNVLLD++F ARVSDFGMARL+SA+DTHLSVSTLAGTPGYVPPEYYQSFRC+ KGDVYSYGV+LLELL+GK+P D  +FG DNNLVGW KQ + + + +++ DPEL+  D + ++ELL +L +AS CLDDRP++RPTMIQVM MFKE+
Sbjct:  978 IPHIIHRDMKSSNVLLDQDFVARVSDFGMARLVSALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPEEFGEDNNLVGWAKQLYREKRGAEILDPELV-TDKSGDVELLHYLKIASQCLDDRPFKRPTMIQVMTMFKEL 1135          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: BRL2_ARATH (Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.710e-54
Identity = 111/181 (61.33%), Postives = 137/181 (75.69%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKL-KISDVFDPELMKEDPN-------------IEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQS 619
            IPHIIHRDMKSSNVLLD++ EARVSDFGMARL+SA+DTHLSVSTLAGTPGYVPPEYYQSFRC+ KGDVYS GVV+LE+L+GKRPTD  +FGD NLVGW K  A+  K  +V D +L+KE  +             I  E+L++L +A  C+DD P +RP M+QV+A  +E++ GS  +S S
Sbjct:  959 IPHIIHRDMKSSNVLLDQDMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSIGVVMLEILSGKRPTDKEEFGDTNLVGWSKMKAREGKHMEVIDEDLLKEGSSESLNEKEGFEGGVIVKEMLRYLEIALRCVDDFPSKRPNMLQVVASLRELR-GSENNSHS 1138          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: EXS_ARATH (Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.231e-36
Identity = 85/161 (52.80%), Postives = 112/161 (69.57%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPT--DSADFGDNNLVGWVKQHAKL-KISDVFDPELMKED-PNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEI 589
            IPHIIHRD+K+SN+LLD +FE +V+DFG+ARL+SA ++H+S + +AGT GY+PPEY QS R +TKGDVYS+GV+LLEL+TGK PT  D  +    NLVGW  Q     K  DV DP L+     N ++ LLQ   +A  CL + P +RP M+ V+   KEI
Sbjct: 1036 IPHIIHRDIKASNILLDGDFEPKVADFGLARLISACESHVS-TVIAGTFGYIPPEYGQSARATTKGDVYSFGVILLELVTGKEPTGPDFKESEGGNLVGWAIQKINQGKAVDVIDPLLVSVALKNSQLRLLQ---IAMLCLAETPAKRPNMLDVLKALKEI 1192          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: PSKR1_ARATH (Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4)

HSP 1 Score: 144.821 bits (364), Expect = 5.721e-34
Identity = 76/158 (48.10%), Postives = 109/158 (68.99%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSA-DFGDNNLVGW-VKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEI 589
            PHI+HRD+KSSN+LLDENF + ++DFG+ARLMS  +TH+S + L GT GY+PPEY Q+   + KGDVYS+GVVLLELLT KRP D     G  +L+ W VK   + + S+VFDP +  ++   + E+ + L +A  CL + P +RPT  Q+++   ++
Sbjct:  854 PHILHRDIKSSNILLDENFNSHLADFGLARLMSPYETHVS-TDLVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTDKRPVDMCKPKGCRDLISWVVKMKHESRASEVFDPLIYSKEN--DKEMFRVLEIACLCLSENPKQRPTTQQLVSWLDDV 1008          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: PSKR1_DAUCA (Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.354e-32
Identity = 75/162 (46.30%), Postives = 106/162 (65.43%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD-SADFGDNNLVGWVKQ-HAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGS 601
            PHI+HRD+KSSN+LL + F A ++DFG+ARL+   DTH++   L GT GY+PPEY Q+   + KGDVYS+GVVLLELLTG+RP D     G  +L+ WV Q   + + S++FDP +  +D   E+ L+  L +A  CL + P  RPT  Q+++  + I   S
Sbjct:  863 PHILHRDIKSSNILLSDTFVAHLADFGLARLILPYDTHVTTD-LVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTGRRPMDVCKPRGSRDLISWVLQMKTEKRESEIFDPFIYDKDHAEEMLLV--LEIACRCLGENPKTRPTTQQLVSWLENIDVSS 1021          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: PSYR1_ARATH (Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 3.837e-30
Identity = 75/160 (46.88%), Postives = 106/160 (66.25%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD-SADFGDNNLVGWVKQHAK-LKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQA 595
            PHI+HRD+KSSN+LLD NF+A V+DFG++RL+    TH++   L GT GY+PPEY Q++  + +GDVYS+GVV+LELLTGKRP +         LV WV    +  K  +VFD  L++E  N E  +L+ L +A  C++  P +RP + QV+   K I+A
Sbjct:  923 PHIVHRDIKSSNILLDGNFKAYVADFGLSRLILPYRTHVTTE-LVGTLGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPMEVFRPKMSRELVAWVHTMKRDGKPEEVFD-TLLRESGN-EEAMLRVLDIACMCVNQNPMKRPNIQQVVDWLKNIEA 1079          
The following BLAST results are available for this feature:
BLAST of DC900011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 291
Match NameE-valueIdentityDescription
BRI1_ARATH1.171e-9585.78Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidops... [more]
BRI1_SOLPE4.460e-8783.33Systemin receptor SR160 OS=Solanum peruvianum PE=1... [more]
BRI1_SOLLC4.460e-8783.33Brassinosteroid LRR receptor kinase OS=Solanum lyc... [more]
BRL1_ARATH1.182e-6364.58Serine/threonine-protein kinase BRI1-like 1 OS=Ara... [more]
BRL3_ARATH5.490e-6172.33Receptor-like protein kinase BRI1-like 3 OS=Arabid... [more]
BRL2_ARATH1.710e-5461.33Serine/threonine-protein kinase BRI1-like 2 OS=Ara... [more]
EXS_ARATH1.231e-3652.80Leucine-rich repeat receptor protein kinase EXS OS... [more]
PSKR1_ARATH5.721e-3448.10Phytosulfokine receptor 1 OS=Arabidopsis thaliana ... [more]
PSKR1_DAUCA5.354e-3246.30Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR... [more]
PSYR1_ARATH3.837e-3046.88Tyrosine-sulfated glycopeptide receptor 1 OS=Arabi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900011 VSS Citrus sinensis cDNA clone VS27Q22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900011 ID=DC900011|Name=DC900011|organism=Citrus sinensis|type=EST|length=850bp
GTTTTTTTTTTTTTTTTTTTAGAGAAAATAGAAATTTTTATATATTAAAA
GGGAAAGGAAGAAACAGACTAGAAAAAAAAAAACTCGAGACTAGCTCGTG
CCGAATTCGGCACGAGGCATCCCACACATTATCCACCGGGATATGAAATC
GAGCAATGTTCTGCTAGACGAAAACTTTGAGGCCAGAGTCTCAGATTTTG
GAATGGCAAGACTAATGAGTGCGATGGATACACATTTGAGTGTCAGTACG
CTAGCAGGCACACCCGGCTATGTCCCTCCCGAATACTATCAAAGCTTTAG
ATGTTCGACGAAAGGCGATGTTTACAGTTATGGTGTAGTTTTGCTCGAGT
TGCTAACGGGAAAAAGGCCAACAGATTCAGCAGATTTCGGTGACAATAAC
CTAGTTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAATAAGCGATGTCTT
TGATCCAGAACTCATGAAAGAGGATCCAAACATCGAGATTGAGCTTCTTC
AACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGACCATGGAGGAGA
CCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAATCCAAGCCGGTTC
AGGACTTGACTCGCAATCTACTATTGCCACTGATGAAGGAGGTTTCGGTA
CAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCAGAACTAAGCACC
AAGCCTTAGNCCATTCAATTTTCAGGACAAGCATTCTTTCAGTGCCCCAA
AATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGGTATCTCTACCATT
TAGTGTATGTAATCTTTGTATCCCTTTTGAAAATTCTTGTTATTTATACA
back to top