DC900009

Overview
NameDC900009
Unique NameDC900009
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length664
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900009 vs. ExPASy Swiss-Prot
Match: CBWD1_RAT (COBW domain-containing protein 1 OS=Rattus norvegicus GN=Cbwd1 PE=2 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 1.744e-23
Identity = 64/181 (35.36%), Postives = 105/181 (58.01%), Query Frame = 1
Query:    4 RLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIHSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVRLWLEEILWDKKM 546
            + D+ILLETTGLA+P  +AS+ W+D +L S + LD IITVVD+K  L  + + +      EA  Q+A AD++++NK DLVS E     L++L   I  IN L  V+ + R +  LS +L+  AYD      L+  L   Q+ S+    D ++ T++   P +   + + ++++ +LW+K +
Sbjct:  128 KFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITVVDSKYGLKHLTEEKPDGLVNEATRQVALADMILINKTDLVSEE----ELNKLRTTIRSINGLGKVLETQRSRTHLSNILDLHAYDTLSGISLQKKL---QHVSTAPHLDQSIVTVTFDVPGSAEEESLNVFIQNLLWEKNV 301          
BLAST of DC900009 vs. ExPASy Swiss-Prot
Match: CBWD1_MOUSE (COBW domain-containing protein 1 OS=Mus musculus GN=Cbwd1 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.975e-23
Identity = 65/181 (35.91%), Postives = 105/181 (58.01%), Query Frame = 1
Query:    4 RLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIHSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVRLWLEEILWDKKM 546
            + D+ILLETTGLA+P  +AS+ W+D +L S + LD IITVVD+K  L  + + +      EA  Q+A AD++++NK DLVS E     L+ L   I  IN L  V+ + R +V LS +L+  AYD      L+  L   Q+ S+    D ++ T++   P +   + + ++++ +LW+K +
Sbjct:  127 KFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITVVDSKYGLKHLTEEKPDGLVNEATRQVALADMILINKTDLVSEE----ELNNLRTTIRSINGLGKVLETQRSRVHLSNILDLHAYDILSGISLQKKL---QHVSTAPHLDQSIVTVTFEVPGSAKEECLNVFIQNLLWEKNV 300          
BLAST of DC900009 vs. ExPASy Swiss-Prot
Match: CBWD3_HUMAN (COBW domain-containing protein 3 OS=Homo sapiens GN=CBWD3 PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.477e-22
Identity = 62/181 (34.25%), Postives = 105/181 (58.01%), Query Frame = 1
Query:    4 RLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIHSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVRLWLEEILWDKKM 546
            + D ILLETTGLA+P  +AS+ W+D +L S + LD IIT+VD+K  L  + + +      EA  Q+A AD++++NK DLV PE   + + +L   I  IN L  ++ + R +VDLS VL+  A+D+     L+  L+      +Q   D ++ T++   P     + + ++++ +LW+K +
Sbjct:  129 KFDDILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADIILINKTDLV-PE---EDVKKLRTTIRSINGLGQILETQRSRVDLSNVLDLHAFDSLSGISLQKKLQ--HVPGTQPHLDQSIVTITFEVPGNAKEEHLNMFIQNLLWEKNV 303          
BLAST of DC900009 vs. ExPASy Swiss-Prot
Match: CBWD1_HUMAN (COBW domain-containing protein 1 OS=Homo sapiens GN=CBWD1 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.477e-22
Identity = 62/181 (34.25%), Postives = 105/181 (58.01%), Query Frame = 1
Query:    4 RLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIHSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVRLWLEEILWDKKM 546
            + D+ILLETTGLA+P  +AS+ W+D +L S + LD IIT+VD+K  L  + + +      EA  Q+A AD +++NK DLV PE   + + +L   I  IN L  ++ + R +VDLS VL+  A+D+     L+  L+      +Q   D ++ T++   P     + + ++++ +LW+K +
Sbjct:  129 KFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADAILINKTDLV-PE---EDVKKLRTTIRSINGLGQILETQRSRVDLSNVLDLHAFDSLSGISLQKKLQ--HVPGTQPHLDQSIVTITFEVPGNAKEEHLNMFIQNLLWEKNV 303          
BLAST of DC900009 vs. ExPASy Swiss-Prot
Match: CBWD6_HUMAN (COBW domain-containing protein 6 OS=Homo sapiens GN=CBWD6 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.929e-22
Identity = 61/181 (33.70%), Postives = 105/181 (58.01%), Query Frame = 1
Query:    4 RLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIHSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVRLWLEEILWDKKM 546
            + D ILLETTGLA+P  +AS+ W+D +L S + LD IIT+VD+K  L  + + +      EA  Q+A AD++++NK DLV PE   + + +L   +  IN L  ++ + R +VDLS VL+  A+D+     L+  L+      +Q   D ++ T++   P     + + ++++ +LW+K +
Sbjct:  129 KFDDILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADIILINKTDLV-PE---EDVKKLRTTLRSINGLGQILETQRSRVDLSNVLDLHAFDSLSGISLQKKLQ--HVPGTQPHLDQSIVTITFDVPGNAKEEHLNMFIQNLLWEKNV 303          
BLAST of DC900009 vs. ExPASy Swiss-Prot
Match: CBWD2_HUMAN (COBW domain-containing protein 2 OS=Homo sapiens GN=CBWD2 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.929e-22
Identity = 62/181 (34.25%), Postives = 105/181 (58.01%), Query Frame = 1
Query:    4 RLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIHSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVRLWLEEILWDKKM 546
            + D+ILLETTGLA+P  +AS+ W+D +L S + LD IIT+VD+K  L  + + +      EA  Q+A AD +++NK DLV PE   + + +L   I  IN L  ++ + R +VDLS VL+  A+D+     L+  L+      +Q   D ++ T++   P     + + ++++ +LW+K +
Sbjct:  129 KFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLAEEKPDGLINEATRQVALADAILINKTDLV-PE---EDVKKLRATIRSINGLGQILETQRSRVDLSNVLDLHAFDSLSGISLQKKLQ--HVPGTQPHLDQSIVTITFEVPGNAKEEHLNMFIQNLLWEKNV 303          
BLAST of DC900009 vs. ExPASy Swiss-Prot
Match: CBWD5_HUMAN (COBW domain-containing protein 5 OS=Homo sapiens GN=CBWD5 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.297e-22
Identity = 61/181 (33.70%), Postives = 104/181 (57.46%), Query Frame = 1
Query:    4 RLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIHSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVRLWLEEILWDKKM 546
            + D ILLETTGLA+P  + S+ W+D +L S + LD IIT+VD+K  L  + + +      EA  Q+A AD++++NK DLV PE   + + +L   I  IN L  ++ + R +VDLS VL+  A+D+     L+  L+      +Q   D ++ T++   P     + + ++++ +LW+K +
Sbjct:  129 KFDDILLETTGLADPGAVTSMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADIILINKTDLV-PE---EDVKKLRTTIRSINGLGQILETQRSRVDLSNVLDLHAFDSLSGISLQKKLQ--HVPGTQPHLDQSIVTITFEVPGNAKEEHLNMFIQNLLWEKNV 303          
BLAST of DC900009 vs. ExPASy Swiss-Prot
Match: YOG5_SCHPO (COBW domain-containing protein C15D4.05 OS=Schizosaccharomyces pombe GN=SPBC15D4.05 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 7.584e-19
Identity = 63/153 (41.18%), Postives = 90/153 (58.82%), Query Frame = 1
Query:    4 RLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIHSVRCQV-DLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNV 459
            R D+I++ETTG+ANP PLA   WLDD L+S V+LD I+TV+D KN    ID      S    I QI+ AD +ILNK DL+S E    +L  + + I +IN LA +I +   ++ D+SE+L+  AY   + + LE         S Q  +D+N+
Sbjct:  149 RFDNIVIETTGIANPGPLAQTFWLDDALKSDVKLDGIVTVIDCKN----IDNILKDESDIGFI-QISHADCLILNKTDLISSE----ALSVVRQTILKINCLAKIIETTYGRLDDISEILDLDAYGNENTSNLEW--------SIQRSNDSNI 284          
BLAST of DC900009 vs. ExPASy Swiss-Prot
Match: YN8H_YEAST (Uncharacterized protein YNR029C OS=Saccharomyces cerevisiae GN=YNR029C PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.882e-18
Identity = 62/205 (30.24%), Postives = 113/205 (55.12%), Query Frame = 1
Query:    4 RLDHILLETTGLANPAPLASVLWLDDQLESAVRLDSIITVVDAKNLL-----FQIDKYRH------LSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIHSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSIC-EPL----AVNLDKVRLWLEEILWDKKMYGCVPLQG 570
            ++D+ILLET+G+A+PAP+A + W D+ L S+V +D IITV+D +++L       ID + H        +   A  Q+A AD +I+NK D +  E S + + +L++ + EINS+A +  +      +  +L+  AYD+    R+  +L+      +  +HD+ + T+ +   PL      N   ++ +L+ +LW  K +G + + G
Sbjct:  159 KIDYILLETSGIADPAPIAKMFWQDEGLNSSVYIDGIITVLDCEHILKCLDDISIDAHWHGDKVGLEGNLTIAHFQLAMADRIIMNKYDTI--EHSPEMVKQLKERVREINSIAPMFFTKYSDTPIQNLLDIHAYDS---VRISDILDSG--SGNGTIHDDRMGTIMLTFRPLKNEEEYNNKFIKQFLQPLLW--KNFGAMTVLG 354          
BLAST of DC900009 vs. ExPASy Swiss-Prot
Match: CBWD7_HUMAN (Putative COBW domain-containing protein 7 OS=Homo sapiens GN=CBWD7 PE=5 SV=3)

HSP 1 Score: 81.6481 bits (200), Expect = 3.895e-15
Identity = 49/161 (30.43%), Postives = 89/161 (55.28%), Query Frame = 1
Query:   64 VLWLDDQLESAVRLDSIITVVDAKNLLFQIDKYRHLSSYPEAIHQIAFADVVILNKVDLVSPERSGDSLDELEKEIHEINSLAHVIHSVRCQVDLSEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVRLWLEEILWDKKM 546
            + W+D +L S + LD IIT+VD+K  L  + + +      EA  Q+A AD++++NK DLV PE   + + +L   I  IN L  ++ + R +VDLS VL+  A+D+     L+  L+      +Q   D ++ T++   P     + + ++++ +LW+K +
Sbjct:    1 MFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADIILINKTDLV-PE---EDVKKLRTTIRSINGLGQILETQRSRVDLSNVLDLHAFDSLSGISLQKKLQ--HVPGTQPHLDQSIVTITFEVPGNAKEEHLNMFIQNLLWEKNV 155          
The following BLAST results are available for this feature:
BLAST of DC900009 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
CBWD1_RAT1.744e-2335.36COBW domain-containing protein 1 OS=Rattus norvegi... [more]
CBWD1_MOUSE2.975e-2335.91COBW domain-containing protein 1 OS=Mus musculus G... [more]
CBWD3_HUMAN1.477e-2234.25COBW domain-containing protein 3 OS=Homo sapiens G... [more]
CBWD1_HUMAN1.477e-2234.25COBW domain-containing protein 1 OS=Homo sapiens G... [more]
CBWD6_HUMAN1.929e-2233.70COBW domain-containing protein 6 OS=Homo sapiens G... [more]
CBWD2_HUMAN1.929e-2234.25COBW domain-containing protein 2 OS=Homo sapiens G... [more]
CBWD5_HUMAN4.297e-2233.70COBW domain-containing protein 5 OS=Homo sapiens G... [more]
YOG5_SCHPO7.584e-1941.18COBW domain-containing protein C15D4.05 OS=Schizos... [more]
YN8H_YEAST2.882e-1830.24Uncharacterized protein YNR029C OS=Saccharomyces c... [more]
CBWD7_HUMAN3.895e-1530.43Putative COBW domain-containing protein 7 OS=Homo ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900009 VSS Citrus sinensis cDNA clone VS27Q21 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900009 ID=DC900009|Name=DC900009|organism=Citrus sinensis|type=EST|length=664bp
GAAAGACTTGATCATATTTTGCTCGAGACCACTGGGTTAGCAAATCCTGC
TCCTCTGGCATCTGTTCTTTGGTTGGATGACCAGCTGGAATCAGCTGTCA
GGCTTGATTCTATTATCACTGTTGTGGATGCCAAAAATCTTCTTTTCCAG
ATTGATAAGTATCGTCACTTGTCTTCGTATCCTGAAGCAATTCATCAAAT
AGCATTTGCTGATGTTGTGATTCTTAACAAGGTCGATTTAGTTTCTCCAG
AGCGTTCTGGAGATTCTCTTGATGAATTGGAGAAGGAAATACATGAAATT
AACTCCCTTGCCCATGTCATCCACTCTGTTCGATGTCAAGTTGACCTGTC
TGAAGTATTGAATTGTCGAGCATATGATGCCACACATGTCACTCGTCTAG
AAGGACTGTTGGAGGAACACCAATATAAATCTTCTCAGAATCTTCATGAC
AATAATGTGCGAACCTTGTCCATTTGTGAACCACTGGCAGTTAATCTTGA
TAAGGTTCGCTTATGGCTTGAGGAGATTCTTTGGGATAAAAAGATGTATG
GATGTGTNCCGTTGCAAGGGGTTTAAGGGTTAACACTCCGATCACTGCTA
CTTGCAGGCTGGGNGGAGATTATGAGATGGTCCGCTCGAAATGGGAACCG
GGGGATCCGTGATA
back to top