DC900008

Overview
NameDC900008
Unique NameDC900008
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length576
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12928 contig Csv1_Contig12928:1448..2022. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900008 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.845e-17
Identity = 66/163 (40.49%), Postives = 86/163 (52.76%), Query Frame = 1
Query:   10 ATPFDYGSGHVNPRAALDPGLIFDAGYVDYLGFLC----TTPGIDIHEIRNYTXQPC-NYSMGHPYNFNTPSITV-AHLVKTQVVTRTVTNVAEEETYSMSARMQ-PAIAIEVNPPAMTLKPGASRK-FTVTLTVRS--VTGTYSFGEICMKGSRGHKVNIPV 468
            +TPFD+G+GHV+P  A +PGLI+D    DYLGFLC    T+P I     RNYT  P  +YS+    + N PS  V    V     TRTVT+V    TYS+    +   + I V P  +  K    +K +TVT TV S   +G+ SFG I     + H V  PV
Sbjct:  594 STPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRNYTCDPSKSYSVA---DLNYPSFAVNVDGVGAYKYTRTVTSVGGAGTYSVKVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGK-HVVGSPV 752          
The following BLAST results are available for this feature:
BLAST of DC900008 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
SUBL_ARATH1.845e-1740.49Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900008 VSS Citrus sinensis cDNA clone VS27Q20 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900008 ID=DC900008|Name=DC900008|organism=Citrus sinensis|type=EST|length=576bp
GTGGTTACAGCTACACCATTTGACTATGGGAGTGGCCATGTCAATCCAAG
AGCTGCCTTGGATCCTGGACTCATATTTGATGCAGGTTACGTGGATTACT
TGGGATTCTTGTGCACGACTCCCGGCATAGACATTCACGAGATAAGAAAC
TACACANACCAACCCTGCAACTACTCAATGGGCCACCCGTATAATTTCAA
TACTCCGTCAATCACAGTCGCCCATCTTGTGAAGACTCAAGTAGTTACAC
GAACAGTCACAAATGTTGCCGAAGAAGAAACCTACTCGATGTCCGCCAGG
ATGCAACCAGCCATTGCCATTGAAGTCAACCCTCCAGCCATGACTCTGAA
ACCTGGTGCTTCACGGAAGTTCACTGTGACCCTCACTGTGAGATCGGTGA
CCGGCACGTACAGTTTTGGGGAAATTTGCATGAAAGGAAGTCGAGGGCAC
AAGGTAAATATCCCGGTGATAGCTCAGGGGAAATTGGCGATGAATTGACT
GATGAGATGCGTTGGGGTCAATGTTAGTTAAGTTGNATCGGTGGAATATT
CTTTGGAATCTGGGGAATAAGATAGC
back to top