DC899996

Overview
NameDC899996
Unique NameDC899996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:292..1287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: APG2_ARATH (GDSL esterase/lipase APG OS=Arabidopsis thaliana GN=APG PE=1 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 4.069e-109
Identity = 190/279 (68.10%), Postives = 229/279 (82.08%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 837
            GKLATD TA+TLGF  Y PAYLSP+A+GKNLLIGANFASA SGYDD+ + LNHAI L QQ++Y++EY+SKL K+AGSK++ SIIK AI ++ AGS DF+QNYYVNPLL KVYT + Y S L++ FS+FIK +Y +GARK GVTSLPP GCLPAARTLFG+HE GCVSR+NTDAQ FNKK+++AA+ LQKQ  DLKIV+FDI+ P+YDLVQ+PSKSGF EA +             LCNPKS GTCSNA+QYVFWDSVHPS+AAN+++A  LI QGF+LL
Sbjct:   74 GKLATDITAETLGFTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIKIAGSKKADSIIKGAICLLSAGSSDFVQNYYVNPLLYKVYTVDAYGSFLIDNFSTFIKQVYAVGARKIGVTSLPPTGCLPAARTLFGFHEKGCVSRLNTDAQNFNKKLNAAASKLQKQYSDLKIVVFDIYSPLYDLVQNPSKSGFTEATKGCCGTGTVETTSLLCNPKSFGTCSNATQYVFWDSVHPSEAANEILATALIGQGFSLL 352          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL78_ARATH (GDSL esterase/lipase At5g22810 OS=Arabidopsis thaliana GN=At5g22810 PE=2 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 1.839e-85
Identity = 152/282 (53.90%), Postives = 210/282 (74.47%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSAS---IIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 837
            GKLATDFTA+ LGFK+Y  AYLS +A GKNLLIGANFASA SGY D T+ L  AISL QQL++Y++Y S++ ++A S  +++   II + IYIV AGS DF+QNYY+NPLL +  +P+++S +L+  +SSFI+N+Y LGAR+ GVT+LPPLGCLPAA T+ G HE GC  ++N DA  FN K+++ + +L++ L  L +V+FDI++P+YDL   PS+ GF EA+R             LCNPKS GTC+NA++YVFWD  HP++AAN+++AD L+V G +L+
Sbjct:   64 GKLATDFTAENLGFKSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRIQEIATSNNNSNASAIISNGIYIVSAGSSDFIQNYYINPLLYRDQSPDEFSDLLILSYSSFIQNLYSLGARRIGVTTLPPLGCLPAAITVVGPHEGGCSEKLNNDAISFNNKLNTTSQDLKRNLIGLNLVVFDIYQPLYDLATRPSEFGFAEARR-ACCGTGLLETSILCNPKSVGTCNNATEYVFWDGFHPTEAANKILADNLLVSGISLI 344          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL73_ARATH (GDSL esterase/lipase At5g03820 OS=Arabidopsis thaliana GN=At5g03820 PE=3 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 3.468e-84
Identity = 148/281 (52.67%), Postives = 205/281 (72.95%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGY--HESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 837
            GKLATDFTA++LGF +Y   YLS +A G NLL GANFAS  SGYDD T+   +AI+L QQL+ Y+EYQ+K+  + GS+++  I   AI+++  GS DFLQ+YY+NP+LN+++TP+QYS  L+  +S+F++N+Y LGARK GVT+LPPLGCLPAA TLFG   + + CV R+N DA  FN K+++ + NL   LP LK+V+FDI+ P+ ++  +P ++GF E++R            FLCN +S GTCSNA+ YVFWD  HPS+AAN+VIA+ L+VQG  L+
Sbjct:   74 GKLATDFTAESLGFTSYPVPYLSQEANGTNLLTGANFASGASGYDDGTAIFYNAITLNQQLKNYKEYQNKVTNIVGSERANKIFSGAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDRLMKPYSTFVQNLYDLGARKIGVTTLPPLGCLPAAITLFGETGNNNTCVERLNQDAVSFNTKLNNTSMNLTNNLPGLKLVVFDIYNPLLNMAMNPVENGFFESRR-ACCGTGTVETSFLCNARSVGTCSNATNYVFWDGFHPSEAANRVIANNLLVQGIPLI 353          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL72_ARATH (GDSL esterase/lipase At5g03810 OS=Arabidopsis thaliana GN=At5g03810 PE=3 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.457e-82
Identity = 147/280 (52.50%), Postives = 203/280 (72.50%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 837
            GKLATDFTA+ LGF +Y  AYLS +A   NLL GANFAS  SG+DD T+   +AI+L+QQL+ Y+EYQ+K+  + G +++  I   AI+++  GS DFLQ+YY+NP+LN+++TP+QYS  L+  +S+F++N+YGLGAR+ GVT+LPPLGCLPAA TLF G   + CV R+N DA  FN K+++ + NL   LP LK+V+FDI+ P+ ++V +P + GF E++R            FLCN  S GTCSNA+ YVFWD  HPS+AAN+VIA+ L+VQG  L+
Sbjct:   74 GKLATDFTAENLGFTSYPVAYLSQEANETNLLTGANFASGASGFDDATAIFYNAITLSQQLKNYKEYQNKVTNIVGKERANEIFSGAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDHLLRSYSTFVQNLYGLGARRIGVTTLPPLGCLPAAITLFGGVGNNMCVERLNQDAVSFNTKLNNTSINLTNNLPGLKLVVFDIYNPLLNMVINPVEYGFFESRR-ACCGTGTMETSFLCNALSVGTCSNATNYVFWDGFHPSEAANRVIANNLLVQGIPLI 352          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL59_ARATH (GDSL esterase/lipase At3g53100 OS=Arabidopsis thaliana GN=At3g53100 PE=2 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 8.563e-75
Identity = 136/279 (48.75%), Postives = 191/279 (68.46%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 837
            GKLA DF+A+ LGF +Y PA+LS +A+ +N+LIGANFASA SGY D TS    +ISLT+QL YYR YQ+++ ++ G   +  +    I+I+ AGS DFLQNYY+NPLLN + TP+Q++ +L+  FS FI+N+Y LGAR+ GV SLPP+GCLPAA TLFG     CV R+N DA  FN K+ +    L  +   L++V F++++P  D++ +P+ +GF E KR            FLCN  S GTC NA+ YVFWD  HP++A N+++A +L+ QG +L+
Sbjct:   73 GKLAVDFSAEYLGFSSYPPAFLSREASNENILIGANFASASSGYYDATSVPFGSISLTRQLSYYRAYQNRVTRMIGRGNARILFSRGIHILSAGSSDFLQNYYINPLLNILNTPDQFADILLRSFSEFIQNLYELGARRIGVISLPPMGCLPAAITLFGAGNKSCVERLNNDAIMFNTKLENTTRLLMNRHSGLRLVAFNVYQPFLDIITNPTDNGFFETKR-ACCGTGTIETSFLCNSLSFGTCVNATGYVFWDGFHPTEAVNELLAGQLLGQGISLI 350          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL90_ARATH (GDSL esterase/lipase At5g42170 OS=Arabidopsis thaliana GN=At5g42160/At5g42170 PE=3 SV=2)

HSP 1 Score: 209.92 bits (533), Expect = 1.856e-53
Identity = 104/272 (38.24%), Postives = 161/272 (59.19%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++ +D  A+ LG     PAYL+P+   ++LL G NFAS GSGYD  T+ L   +SL+ QL+ ++EY++KL  + G +++  ++K+++Y+V A S D    Y    +    Y    Y+  L +  S F+  +YGLGAR+ GV S  P+GC+PAARTL G  +  C  ++N  A+ FN K+S     L K+LPD ++V+ D+   + D++++P   GF E               FLCN  +P TC N+S Y+FWDS HP++ A Q+I D+L+
Sbjct:   94 GRVPSDIVAERLGIAETIPAYLNPKLKNEDLLKGVNFASGGSGYDPLTAKLVKVVSLSDQLKNFQEYKNKLKVIVGEEKANFLVKNSLYLVVASSNDIAHTYTARSIK---YNKTSYADYLADSASKFVSALYGLGARRIGVFSAVPVGCVPAARTLRGKLKRRCSEKLNEVARNFNAKISPTLEALGKELPDSRVVLIDVCDTLNDMIENPKNYGF-EVSNRGCCGTGLVEVLFLCNKINPFTCKNSSSYIFWDSYHPTEKAYQIIVDKLL 361          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL34_ARATH (GDSL esterase/lipase At2g04570 OS=Arabidopsis thaliana GN=At2g04570 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.330e-51
Identity = 102/276 (36.96%), Postives = 150/276 (54.35%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGF 828
            GK+ATDF ++ LG K   PAYL P     +   G  FASA +GYD+ TS +   + L +QL+YY+EYQ+KL    G  +    I+ ++Y++  G+ DFL+NY+  P  +  Y+   Y   L  I   F+K ++GLGARK  +  LPP+GC+P  R         CV R N  A QFN K+      L K+LP   +V  + ++P   ++++PS  GF E               + C   +P TC+NA +YVFWDS HP+Q  N ++A+ L+   F
Sbjct:   72 GKIATDFMSEALGLKPIIPAYLDPSYNISDFATGVTFASAATGYDNATSDVLSVLPLWKQLEYYKEYQTKLKAYQGKDRGTETIESSLYLISIGTNDFLENYFAFPGRSSQYSVSLYQDFLAGIAKEFVKKLHGLGARKISLGGLPPMGCMPLERATNIGTGGECVGRYNDIAVQFNSKLDKMVEKLSKELPGSNLVFSNPYEPFMRIIKNPSSFGF-EVVGAACCATGMFEMGYGCQRNNPFTCTNADKYVFWDSFHPTQKTNHIMANALMNSTF 346          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL66_ARATH (GDSL esterase/lipase At4g26790 OS=Arabidopsis thaliana GN=At4g26790 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.377e-48
Identity = 93/272 (34.19%), Postives = 157/272 (57.72%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++A DF ++ LG K   PAYL P     +   G  FASAG+G D+ TS +   + L ++++YY+EYQ++L    G +++  II +++Y++  G+ DFL+NYY+ P   + Y+  +Y   L+ I + F+ ++Y LGARK  ++ L P GCLP  RT   ++ S C+   N  A+ FN K+      L + L  +++V  + +  + +++  P   GF E  R            +LC+  +P TCS+AS+YVFWDS HP++  N ++A+ ++
Sbjct:   73 GRIAPDFISEGLGLKNAVPAYLDPAYNIADFATGVCFASAGTGLDNATSAVLSVMPLWKEVEYYKEYQTRLRSYLGEEKANEIISESLYLISIGTNDFLENYYLLPRKLRKYSVNEYQYFLIGIAADFVTDIYRLGARKMSLSGLSPFGCLPLERTTQLFYGSKCIEEYNIVARDFNIKMEEKVFQLNRDLNGIQLVFSNPYDLVSEIIYHPEAFGF-ENVRSACCGTGYYEMSYLCDKMNPFTCSDASKYVFWDSFHPTEKTNAIVANHVL 343          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL48_ARATH (GDSL esterase/lipase At2g42990 OS=Arabidopsis thaliana GN=At2g42990 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.377e-48
Identity = 97/269 (36.06%), Postives = 153/269 (56.88%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIAD 807
            G+L++DFT++  G K   PAYL P     +   G  FASAG+GYD+ T+ +   I L ++++Y++EYQS L+   G +++A II++++YIV  G+ DFL+NYY  P     ++  QY   LV I   F+K++Y LGARK   T + P+GCLP  R         C    N  A  FN ++    T L ++L  +KI   + +  ++D+V  P+  G +E               FLC   +P TCS+A+++VFWD+ HP++  NQ+++D
Sbjct:   72 GRLSSDFTSEAYGLKPTVPAYLDPSYNISDFATGVCFASAGTGYDNSTADVLGVIPLWKEVEYFKEYQSNLSAYLGHRRAAKIIRESLYIVSIGTNDFLENYYTLPDRRSQFSISQYQDFLVEIAEVFLKDIYRLGARKMSFTGISPMGCLPLERVTNLDDPFSCARSYNDLAVDFNGRLRRLVTKLNRELTGIKIYFANPYDIMWDIVTKPNLYG-LEISSSACCGTGLFEMGFLCGQDNPLTCSDANKFVFWDAFHPTERTNQIVSD 339          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL89_ARATH (GDSL esterase/lipase At5g63170 OS=Arabidopsis thaliana GN=At5g63170 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 5.231e-48
Identity = 101/275 (36.73%), Postives = 150/275 (54.55%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSA-SIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQ 822
            G++ TD  A+ LG K   PAY SP     ++L G +FAS GSG D  T+ +   I +  QL  ++ Y +KL  + G ++   SII +A++++ AG+ D    Y+ NP+ N  YT   Y+ ++V+   SFIK +Y LGARKF +    PLGCLP A    G     C+   N  A+ FN+K++    NL   LP  + +  D++ P+ +LV++P +SGF+   R              C P +P  C +AS+YVFWD  HPS+ A Q I   +I Q
Sbjct:   72 GRIPTDLIAEGLGIKNIVPAYRSPFLEPNDILTGVSFASGGSGLDPMTARIQGVIWVPDQLNDFKAYIAKLNSITGDEEKTRSIISNAVFVISAGNNDIAITYFTNPIRNTRYTIFSYTDLMVSWTQSFIKELYNLGARKFAIMGTLPLGCLPGASNALG---GLCLEPANAVARLFNRKLADEVNNLNSMLPGSRSIYVDMYNPLLELVKNPLRSGFISPTRPC-----------CCAPAAPIPCLDASRYVFWDIAHPSEKAYQTIIPPIIQQ 332          
The following BLAST results are available for this feature:
BLAST of DC899996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
APG2_ARATH4.069e-10968.10GDSL esterase/lipase APG OS=Arabidopsis thaliana G... [more]
GDL78_ARATH1.839e-8553.90GDSL esterase/lipase At5g22810 OS=Arabidopsis thal... [more]
GDL73_ARATH3.468e-8452.67GDSL esterase/lipase At5g03820 OS=Arabidopsis thal... [more]
GDL72_ARATH1.457e-8252.50GDSL esterase/lipase At5g03810 OS=Arabidopsis thal... [more]
GDL59_ARATH8.563e-7548.75GDSL esterase/lipase At3g53100 OS=Arabidopsis thal... [more]
GDL90_ARATH1.856e-5338.24GDSL esterase/lipase At5g42170 OS=Arabidopsis thal... [more]
GDL34_ARATH1.330e-5136.96GDSL esterase/lipase At2g04570 OS=Arabidopsis thal... [more]
GDL66_ARATH1.377e-4834.19GDSL esterase/lipase At4g26790 OS=Arabidopsis thal... [more]
GDL48_ARATH1.377e-4836.06GDSL esterase/lipase At2g42990 OS=Arabidopsis thal... [more]
GDL89_ARATH5.231e-4836.73GDSL esterase/lipase At5g63170 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899996 VSS Citrus sinensis cDNA clone VS27Q07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899996 ID=DC899996|Name=DC899996|organism=Citrus sinensis|type=EST|length=996bp
GGGAAATTAGCCACTGACTTCACTGCTGATACCCTAGGCTTTAAGACTTA
TGCGCCAGCATATCTCAGTCCACAGGCTACAGGGAAAAACCTCCTTATTG
GAGCCAACTTTGCTTCAGCGGGATCTGGTTATGATGACAGGACATCCTAC
TTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTACTATAGAGAGTA
CCAGAGTAAGCTAGCAAAGGTAGCTGGTAGCAAACAATCAGCTTCCATAA
TCAAGGATGCGATATACATAGTGGGTGCTGGGAGTGGTGACTTTCTTCAG
AATTACTATGTCAATCCTTTACTTAACAAAGTCTACACTCCTGAGCAGTA
TAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAAGAACATGTATG
GATTGGGAGCAAGAAAATTTGGAGTGACTTCACTGCCACCATTGGGTTGC
CTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGTGGCTGTGTCTC
TAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGTCAGCTCCGCAG
CAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTGTGATTTTCGAC
ATTTTCAAGCCAATCTATGACCTTGTCCAATCCCCTTCAAAATCTGGCTT
CGTGGAGGCAAAAAGAGGTTGCTGTGGAACAGGAACTGTAGAAACAACTG
TCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCAATGCCTCTCAG
TATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCTAATCAGGTTAT
TGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTGAAGGGGATGTC
AAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCTTAATCTTCTTG
GTGTCTGTGCTTCAGTTTATCTGCTTGTCTATACATCATTTTAAGATTTC
CTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTTTTGCTAC
back to top