DC899995

Overview
NameDC899995
Unique NameDC899995
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length590
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4020 contig Csv1_Contig4020:168..757. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899995 vs. ExPASy Swiss-Prot
Match: GBA2_MOUSE (Non-lysosomal glucosylceramidase OS=Mus musculus GN=Gba2 PE=2 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 8.399e-21
Identity = 51/90 (56.67%), Postives = 59/90 (65.56%), Query Frame = 3
Query:    3 GMHPNGKVDETCMQSREIWTGVTYGVAATMILAGMEKEAFTTAEGIFTAGWSEEGYGYWFQTPEAWTMDGHFRSLIYMRPLSIWGMQWAL 272
            GMHP+G  D + +QS E+W GV YG+AATMI  G+  E F TAEG +   W  E  G  FQTPEA+     FRSL YMRPLSIW MQ AL
Sbjct:  794 GMHPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCYRTVW--ERLGLAFQTPEAYCQQQVFRSLAYMRPLSIWAMQLAL 881          
BLAST of DC899995 vs. ExPASy Swiss-Prot
Match: GBA2_HUMAN (Non-lysosomal glucosylceramidase OS=Homo sapiens GN=GBA2 PE=1 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 5.444e-20
Identity = 50/90 (55.56%), Postives = 59/90 (65.56%), Query Frame = 3
Query:    3 GMHPNGKVDETCMQSREIWTGVTYGVAATMILAGMEKEAFTTAEGIFTAGWSEEGYGYWFQTPEAWTMDGHFRSLIYMRPLSIWGMQWAL 272
            GM P+G  D++ +QS E+W GV YG+AATMI  G+  E F TAEG +   W  E  G  FQTPEA+     FRSL YMRPLSIW MQ AL
Sbjct:  803 GMQPHGVPDKSSVQSDEVWVGVVYGLAATMIQEGLTWEGFQTAEGCYRTVW--ERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLAL 890          
BLAST of DC899995 vs. ExPASy Swiss-Prot
Match: GBA2_RAT (Non-lysosomal glucosylceramidase OS=Rattus norvegicus GN=Gba2 PE=2 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 7.110e-20
Identity = 50/90 (55.56%), Postives = 58/90 (64.44%), Query Frame = 3
Query:    3 GMHPNGKVDETCMQSREIWTGVTYGVAATMILAGMEKEAFTTAEGIFTAGWSEEGYGYWFQTPEAWTMDGHFRSLIYMRPLSIWGMQWAL 272
            GM P+G  D + +QS E+W GV YG+AATMI  G+  E F TAEG +   W  E  G  FQTPEA+     FRSL YMRPLSIW MQ AL
Sbjct:  794 GMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCYRTVW--ERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLAL 881          
BLAST of DC899995 vs. ExPASy Swiss-Prot
Match: C3390_DROME (Non-lysosomal glucosylceramidase OS=Drosophila melanogaster GN=CG33090 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.004e-14
Identity = 42/85 (49.41%), Postives = 55/85 (64.71%), Query Frame = 3
Query:   18 GKVDETCMQSREIWTGVTYGVAATMILAGMEKEAFTTAEGIFTAGWSEEGYGYWFQTPEAWTMDGHFRSLIYMRPLSIWGMQWAL 272
            G VD + +Q+ E+W GV Y +AATMI  GM +EAF TA G++      +  G  F+TPEA   +  +RS+ YMRPLSIW MQ AL
Sbjct:  858 GHVDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYKT--LSQRIGMNFETPEALYGEKRYRSIGYMRPLSIWSMQVAL 940          
The following BLAST results are available for this feature:
BLAST of DC899995 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
GBA2_MOUSE8.399e-2156.67Non-lysosomal glucosylceramidase OS=Mus musculus G... [more]
GBA2_HUMAN5.444e-2055.56Non-lysosomal glucosylceramidase OS=Homo sapiens G... [more]
GBA2_RAT7.110e-2055.56Non-lysosomal glucosylceramidase OS=Rattus norvegi... [more]
C3390_DROME2.004e-1449.41Non-lysosomal glucosylceramidase OS=Drosophila mel... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC899995 VSS Citrus sinensis cDNA clone VS27Q06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899995 ID=DC899995|Name=DC899995|organism=Citrus sinensis|type=EST|length=590bp
ATGGAATGCATCCAAATGGGAAAGTGGATGAGACTTGCATGCAGTCACGT
GAAATATGGACAGGTGTAACGTACGGTGTGGCAGCTACCATGATCCTTGC
TGGAATGGAGAAAGAGGCATTCACTACTGCCGAAGGCATCTTCACTGCAG
GCTGGTCAGAAGAGGGCTATGGATACTGGTTTCAGACCCCTGAGGCATGG
ACAATGGACGGGCACTTCCGGTCCCTTATATATATGAGGCCTCTCTCAAT
TTGGGGCATGCAGTGGGCGCTATCTATGCCTAAAACAGTTCTCCAGGCTC
CTGAGATCAATATAATGGATAGAATAAGCATATCCCCTTCTGCTGCAGCA
ATATCGCACGAATTTGGAGTTAGAAAGATAGCAAACAAAGCAAAGTGTTT
CGGAGCTGCTGTGTTTCATTGTTCATGCTAACTATCAAATGTAAGTGCCC
CCCACCCCATCTTTGTAAAGATGTTAATTTGTTTGCTTCGTTGAACCCTC
TTCCAGCTAAAAAGATAAAATGCCGGAAGAGGCTTTGAGGAAGTGTTTCT
TTCATAGACAAGCAATAAAAACCAAGTTAATTCTGTAGCT
back to top