CN185706

Overview
NameCN185706
Unique NameCN185706
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length712
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6145 contig Csv1_Contig6145:33..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185706 vs. ExPASy Swiss-Prot
Match: SODM_HEVBR (Superoxide dismutase [Mn], mitochondrial OS=Hevea brasiliensis GN=SODA PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 2.318e-97
Identity = 113/130 (86.92%), Postives = 117/130 (90.00%), Query Frame = 1
Query:  322 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQK 711
            GHVNHSIFWKNLAPV EGGGE PH SLGWAID  FGSLE LIQ M+AEGAALQGSGWVWL LD E K+LVVETTANQDPLVTK PTLVPLLGIDVWEHAYYLQYKNV+PDYLKNIW VMNWKYAS+VY K
Sbjct:   99 GHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGAALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYASEVYAK 228          

HSP 2 Score: 133.65 bits (335), Expect = 2.318e-97
Identity = 69/97 (71.13%), Postives = 78/97 (80.41%), Query Frame = 2
Query:   38 MALRSLATRKAI--GLGKSVGLG-LRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNG 319
            MALRSL TRK +      + GLG LRGLQT +LPDLPYDY ALEPAISGEIMQLHHQKHHQ Y+TNYNKA+EQL  A+ K D++ VV+LQ AIKFNG
Sbjct:    1 MALRSLVTRKNLPSAFKAATGLGQLRGLQTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVKLQSAIKFNG 97          
BLAST of CN185706 vs. ExPASy Swiss-Prot
Match: SODM_PRUPE (Superoxide dismutase [Mn], mitochondrial OS=Prunus persica GN=SOD PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 2.318e-97
Identity = 113/130 (86.92%), Postives = 122/130 (93.85%), Query Frame = 1
Query:  322 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQK 711
            GH+NHSIFWKNLAPV EGGGEPP  SLGWAIDT+FGSLEAL+QKM+AEGAALQGSGWVWL LD E K+LVVETTANQDPLVTK PTLVPLLGIDVWEHAYYLQYKNV+PDYLKNIW V+NWKYAS+VY+K
Sbjct:   96 GHINHSIFWKNLAPVREGGGEPPKGSLGWAIDTNFGSLEALVQKMNAEGAALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 225          

HSP 2 Score: 127.102 bits (318), Expect = 2.318e-97
Identity = 61/94 (64.89%), Postives = 72/94 (76.60%), Query Frame = 2
Query:   38 MALRSLATRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNG 319
            MALR+L +R+ +  G      LRGLQT +LPDLPY+Y ALEPAISG+IMQLHHQ HHQ YVTNYNKA+EQL  A++K D  TV +L  AIKFNG
Sbjct:    1 MALRTLVSRRTLATGLGFRQQLRGLQTFSLPDLPYNYGALEPAISGDIMQLHHQNHHQTYVTNYNKALEQLHDAISKGDAPTVAKLHSAIKFNG 94          
BLAST of CN185706 vs. ExPASy Swiss-Prot
Match: SODM_NICPL (Superoxide dismutase [Mn], mitochondrial OS=Nicotiana plumbaginifolia GN=SODA PE=1 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.143e-96
Identity = 110/130 (84.62%), Postives = 121/130 (93.08%), Query Frame = 1
Query:  322 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQK 711
            GH+NHSIFWKNLAPV EGGGEPP  SLGWAIDT+FGSLEAL+QKM+AEGAALQGSGWVWLG+D E KRLV+ETTANQDPLV+K   LVPLLGIDVWEHAYYLQYKNV+PDYLKNIW VMNWKYA++VY+K
Sbjct:   96 GHINHSIFWKNLAPVREGGGEPPKGSLGWAIDTNFGSLEALVQKMNAEGAALQGSGWVWLGVDKELKRLVIETTANQDPLVSKGANLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYANEVYEK 225          

HSP 2 Score: 129.028 bits (323), Expect = 1.143e-96
Identity = 62/94 (65.96%), Postives = 72/94 (76.60%), Query Frame = 2
Query:   38 MALRSLATRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNG 319
            MALR+L +R+ +  G      LRGLQT +LPDLPYDY ALEPAISG+IMQLHHQ HHQ YVTNYNKA+EQL  A++K D  TV +L  AIKFNG
Sbjct:    1 MALRTLVSRRTLATGLGFRQQLRGLQTFSLPDLPYDYGALEPAISGDIMQLHHQNHHQTYVTNYNKALEQLHDAISKGDAPTVAKLHSAIKFNG 94          
BLAST of CN185706 vs. ExPASy Swiss-Prot
Match: SODM_ARATH (Superoxide dismutase [Mn], mitochondrial OS=Arabidopsis thaliana GN=SODA PE=1 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 1.369e-94
Identity = 105/130 (80.77%), Postives = 118/130 (90.77%), Query Frame = 1
Query:  322 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQK 711
            GHVNHSIFWKNLAP  EGGGEPP  SLG AID HFGSLE L++KMSAEGAA+QGSGWVWLGLD E K+LVV+TTANQDPLVTK  +LVPL+GIDVWEHAYYLQYKNV+P+YLKN+W V+NWKYAS+VY+K
Sbjct:   99 GHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEK 228          

HSP 2 Score: 134.806 bits (338), Expect = 1.369e-94
Identity = 68/97 (70.10%), Postives = 78/97 (80.41%), Query Frame = 2
Query:   38 MALRSLATRKAIGLGKSVG---LGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNG 319
            MA+R +A+RK +   K      L +RG+QT TLPDLPYDY ALEPAISGEIMQ+HHQKHHQAYVTNYN A+EQL QA+NK D STVV+LQ AIKFNG
Sbjct:    1 MAIRCVASRKTLAGLKETSSRLLRIRGIQTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKGDASTVVKLQSAIKFNG 97          
BLAST of CN185706 vs. ExPASy Swiss-Prot
Match: SODM_CAPAN (Superoxide dismutase [Mn], mitochondrial OS=Capsicum annuum GN=SODA PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 2.551e-93
Identity = 109/130 (83.85%), Postives = 119/130 (91.54%), Query Frame = 1
Query:  322 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQK 711
            GH+NHS+FWKNLAP  EGGGEPP  SLG AIDT+FGSLEA+IQKM+AEGAALQGSGWVWLGLD E KRLV+ETTANQDPLV K P LVPLLGIDVWEHAYYLQYKNVKPDYLKNIW V+NWKYA++VY+K
Sbjct:   96 GHINHSVFWKNLAPTREGGGEPPKGSLGSAIDTNFGSLEAVIQKMNAEGAALQGSGWVWLGLDKELKRLVIETTANQDPLVIKGPNLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWKVINWKYAAEVYEK 225          

HSP 2 Score: 122.865 bits (307), Expect = 2.551e-93
Identity = 61/94 (64.89%), Postives = 72/94 (76.60%), Query Frame = 2
Query:   38 MALRSLATRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNG 319
            MALR+L T+K      +    LR +QT +LPDL YDY ALEPAISGEIMQLHHQKHHQ Y+TNYN A++QL  A+NK D+ TV +LQGAIKFNG
Sbjct:    1 MALRNLMTKKPFAGILTFRQQLRCVQTFSLPDLSYDYGALEPAISGEIMQLHHQKHHQTYITNYNNALQQLHDAINKGDSPTVAKLQGAIKFNG 94          
BLAST of CN185706 vs. ExPASy Swiss-Prot
Match: SODM1_MAIZE (Superoxide dismutase [Mn] 3.1, mitochondrial OS=Zea mays GN=SODA.4 PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 1.647e-89
Identity = 103/129 (79.84%), Postives = 113/129 (87.60%), Query Frame = 1
Query:  322 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 708
            GHVNHSIFWKNL P+ EGGGEPPH  LGWAID  FGS EAL++KM+AEGAALQGSGWVWL LD E K++ VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:  103 GHVNHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSFEALVKKMNAEGAALQGSGWVWLALDKEAKKVSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 231          

HSP 2 Score: 120.168 bits (300), Expect = 1.647e-89
Identity = 63/101 (62.38%), Postives = 75/101 (74.26%), Query Frame = 2
Query:   38 MALRSLATRKAI-----GLGK--SVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNG 319
            MALR+LA++K +     G G+  +     RG+ TVTLPDL YD+ ALEPAISGEIM+LHHQKHH  YV NYNKA+EQL  A++K D S VVQLQ AIKFNG
Sbjct:    1 MALRTLASKKVLSFPFGGAGRPLAAAASARGVTTVTLPDLSYDFGALEPAISGEIMRLHHQKHHATYVANYNKALEQLETAVSKGDASAVVQLQAAIKFNG 101          
BLAST of CN185706 vs. ExPASy Swiss-Prot
Match: SODM_ORYSJ (Superoxide dismutase [Mn], mitochondrial OS=Oryza sativa subsp. japonica GN=SODA PE=2 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 3.656e-89
Identity = 103/129 (79.84%), Postives = 112/129 (86.82%), Query Frame = 1
Query:  322 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 708
            GHVNHSIFW NL P+ EGGG+PPH+ LGWAID  FGS EAL++KMSAEGAALQGSGWVWL LD E K+L VETTANQDPLVTK   LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:   99 GHVNHSIFWNNLKPISEGGGDPPHAKLGWAIDEDFGSFEALVKKMSAEGAALQGSGWVWLALDKEAKKLSVETTANQDPLVTKGANLVPLLGIDVWEHAYYLQYKNVRPDYLSNIWKVMNWKYAGEVYE 227          

HSP 2 Score: 119.783 bits (299), Expect = 3.656e-89
Identity = 62/97 (63.92%), Postives = 70/97 (72.16%), Query Frame = 2
Query:   38 MALRSLATRK---AIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNG 319
            MALR+LA+RK   A  L  +     RG+ TV LPDLPYDY ALEPAISGEIM+LHHQKHH  YV NYNKA+EQL  A+ K D   +V LQ AIKFNG
Sbjct:    1 MALRTLASRKTLAAAALPLAAAAAARGVTTVALPDLPYDYGALEPAISGEIMRLHHQKHHATYVANYNKALEQLDAAVAKGDAPAIVHLQSAIKFNG 97          
BLAST of CN185706 vs. ExPASy Swiss-Prot
Match: SODM4_MAIZE (Superoxide dismutase [Mn] 3.4, mitochondrial OS=Zea mays GN=SODA.3 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 4.769e-89
Identity = 103/129 (79.84%), Postives = 113/129 (87.60%), Query Frame = 1
Query:  322 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 708
            GHVNHSIFWKNL P+ EGGGEPPH  LGWAID  FGS EAL+++M+AEGAALQGSGWVWL LD E K+L VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:  101 GHVNHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSFEALVKRMNAEGAALQGSGWVWLALDKEPKKLSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 229          

HSP 2 Score: 119.398 bits (298), Expect = 4.769e-89
Identity = 62/99 (62.63%), Postives = 72/99 (72.73%), Query Frame = 2
Query:   38 MALRSLATRKAI-----GLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNG 319
            MALR+LA++ A+     G  +      RG+ TV LPDL YD+ ALEPAISGEIM+LHHQKHH  YV NYNKA+EQL  A+ K D S VVQLQGAIKFNG
Sbjct:    1 MALRTLASKNALSFALGGAARPSAASARGVTTVALPDLSYDFGALEPAISGEIMRLHHQKHHATYVGNYNKALEQLDAAVAKGDASAVVQLQGAIKFNG 99          
BLAST of CN185706 vs. ExPASy Swiss-Prot
Match: SODM3_MAIZE (Superoxide dismutase [Mn] 3.3, mitochondrial OS=Zea mays GN=SODA.2 PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 7.442e-87
Identity = 102/129 (79.07%), Postives = 113/129 (87.60%), Query Frame = 1
Query:  322 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 708
            GHVNHSIFWKNL P+ EGGGEPPH  LGWAID  FGS EAL+++M+AEGAALQGSGWVWL LD E K++ VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:  101 GHVNHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSFEALVKRMNAEGAALQGSGWVWLALDKEAKKVSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 229          

HSP 2 Score: 112.464 bits (280), Expect = 7.442e-87
Identity = 58/99 (58.59%), Postives = 70/99 (70.71%), Query Frame = 2
Query:   38 MALRSLATRKAI-----GLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNG 319
            MALR+LA++ A+     G  +      RG+ TV LPDL YD+ ALEP ISGEIM+LHHQK+H  YV NYNKA+EQ+   + K D S VVQLQGAIKFNG
Sbjct:    1 MALRTLASKNALSFALGGAARPSAESARGVTTVALPDLSYDFGALEPVISGEIMRLHHQKNHATYVVNYNKALEQIDDVVVKGDDSAVVQLQGAIKFNG 99          
BLAST of CN185706 vs. ExPASy Swiss-Prot
Match: SODM_PEA (Superoxide dismutase [Mn], mitochondrial OS=Pisum sativum GN=SODA PE=2 SV=2)

HSP 1 Score: 217.624 bits (553), Expect = 4.009e-85
Identity = 104/130 (80.00%), Postives = 115/130 (88.46%), Query Frame = 1
Query:  322 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQK 711
            GH+NHSIFWKNLAPV EGGGEPP  SLGWAIDT+FGSLEALIQK++AEGAALQ     WLGLD + KRLVVETT  QDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYLKNIW V+NWK+AS+VY+K
Sbjct:  108 GHINHSIFWKNLAPVSEGGGEPPKESLGWAIDTNFGSLEALIQKINAEGAALQ-----WLGLDKDLKRLVVETT--QDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKHASEVYEK 230          

HSP 2 Score: 119.013 bits (297), Expect = 4.009e-85
Identity = 62/106 (58.49%), Postives = 71/106 (66.98%), Query Frame = 2
Query:   38 MALRSLATRKAIGL-----GKSVGLGL-------RGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVVQLQGAIKFNG 319
            MA R+L  RK +        K +G  +       RGL   TLPDL YDY ALEP ISGEIMQ+HHQKHHQ Y+TNYNKA+EQL  A+ K DTST V+LQ AIKFNG
Sbjct:    1 MAARTLLCRKTLSSVLRNDAKPIGAAIAAASTQSRGLHVFTLPDLAYDYGALEPVISGEIMQIHHQKHHQTYITNYNKALEQLHDAVAKADTSTTVKLQNAIKFNG 106          
The following BLAST results are available for this feature:
BLAST of CN185706 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 221
Match NameE-valueIdentityDescription
SODM_HEVBR2.318e-9786.92Superoxide dismutase [Mn], mitochondrial OS=Hevea ... [more]
SODM_PRUPE2.318e-9786.92Superoxide dismutase [Mn], mitochondrial OS=Prunus... [more]
SODM_NICPL1.143e-9684.62Superoxide dismutase [Mn], mitochondrial OS=Nicoti... [more]
SODM_ARATH1.369e-9480.77Superoxide dismutase [Mn], mitochondrial OS=Arabid... [more]
SODM_CAPAN2.551e-9383.85Superoxide dismutase [Mn], mitochondrial OS=Capsic... [more]
SODM1_MAIZE1.647e-8979.84Superoxide dismutase [Mn] 3.1, mitochondrial OS=Ze... [more]
SODM_ORYSJ3.656e-8979.84Superoxide dismutase [Mn], mitochondrial OS=Oryza ... [more]
SODM4_MAIZE4.769e-8979.84Superoxide dismutase [Mn] 3.4, mitochondrial OS=Ze... [more]
SODM3_MAIZE7.442e-8779.07Superoxide dismutase [Mn] 3.3, mitochondrial OS=Ze... [more]
SODM_PEA4.009e-8580.00Superoxide dismutase [Mn], mitochondrial OS=Pisum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001M01_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001M01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185706 ID=CN185706|Name=CN185706|organism=Citrus sinensis|type=EST|length=712bp
TTTCGAACGACTCTTAAACGTCACCGTTTCATTCGCGATGGCTCTCCGTT
CGCTCGCCACCAGAAAAGCTATAGGCTTGGGTAAATCCGTAGGATTAGGG
CTACGTGGACTGCAGACGGTCACGCTGCCTGATCTTCCGTACGATTACAG
CGCTTTGGAGCCGGCGATTAGCGGAGAGATTATGCAGCTTCATCACCAGA
AGCATCACCAGGCTTACGTTACTAACTACAACAAGGCGGTCGAGCAGCTT
TTTCAAGCTTTGAACAAAGTCGACACTTCCACCGTCGTCCAGTTGCAGGG
CGCTATCAAGTTCAACGGCGAGGTCATGTCAACCACTCAATTTTCTGGAA
GAATCTTGCTCCTGTTCACGAAGGAGGTGGCGAGCCACCACATAGTTCCC
TTGGTTGGGCTATTGACACGCATTTTGGTTCTCTGGAAGCATTGATACAA
AAGATGAGTGCTGAGGGTGCAGCTTTGCAGGGCTCTGGATGGGTGTGGCT
TGGTTTAGATACAGAGTTTAAAAGGCTTGTGGTTGAAACTACTGCAAATC
AGGATCCACTGGTGACTAAAGCCCCAACTCTGGTTCCTTTGCTTGGTATA
GATGTTTGGGAGCATGCATACTACCTACAGTACAAGAATGTCAAACCAGA
TTATCTGAAAAACATTTGGAACGTAATGAACTGGAAGTATGCTAGTGATG
TGTATCAGAAAG
back to top