CN185705

Overview
NameCN185705
Unique NameCN185705
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6145 contig Csv1_Contig6145:261..1058. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185705 vs. ExPASy Swiss-Prot
Match: SODM_PRUPE (Superoxide dismutase [Mn], mitochondrial OS=Prunus persica GN=SOD PE=2 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 4.182e-68
Identity = 121/164 (73.78%), Postives = 135/164 (82.32%), Query Frame = -2
Query:  306 NKAVEQLFSSFEQSRHFHRRPVAGRYQVQRRGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP 797
            NKA+EQL  +  +        +    +    GH+NHSIFWKNLAPV EGGGEPP  SLGWAIDT+FGSLEAL+QKM+AEGAALQGSGWVWL LD E K+LVVETTANQDPLVTK PTLVPLLGIDVWEHAYYLQYKNV+PDYLKNIW V+NWKYAS+VY+KE P
Sbjct:   65 NKALEQLHDAISKGDAPTVAKLHSAIKFNGGGHINHSIFWKNLAPVREGGGEPPKGSLGWAIDTNFGSLEALVQKMNAEGAALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKESP 228          
BLAST of CN185705 vs. ExPASy Swiss-Prot
Match: SODM_NICPL (Superoxide dismutase [Mn], mitochondrial OS=Nicotiana plumbaginifolia GN=SODA PE=1 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 5.462e-68
Identity = 119/164 (72.56%), Postives = 135/164 (82.32%), Query Frame = -2
Query:  306 NKAVEQLFSSFEQSRHFHRRPVAGRYQVQRRGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP 797
            NKA+EQL  +  +        +    +    GH+NHSIFWKNLAPV EGGGEPP  SLGWAIDT+FGSLEAL+QKM+AEGAALQGSGWVWLG+D E KRLV+ETTANQDPLV+K   LVPLLGIDVWEHAYYLQYKNV+PDYLKNIW VMNWKYA++VY+KECP
Sbjct:   65 NKALEQLHDAISKGDAPTVAKLHSAIKFNGGGHINHSIFWKNLAPVREGGGEPPKGSLGWAIDTNFGSLEALVQKMNAEGAALQGSGWVWLGVDKELKRLVIETTANQDPLVSKGANLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYANEVYEKECP 228          
BLAST of CN185705 vs. ExPASy Swiss-Prot
Match: SODM_HEVBR (Superoxide dismutase [Mn], mitochondrial OS=Hevea brasiliensis GN=SODA PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 7.134e-68
Identity = 123/164 (75.00%), Postives = 132/164 (80.49%), Query Frame = -2
Query:  306 NKAVEQLFSSFEQSRHFHRRPVAGRYQVQRRGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP 797
            NKA+EQL  + E+        +    +    GHVNHSIFWKNLAPV EGGGE PH SLGWAID  FGSLE LIQ M+AEGAALQGSGWVWL LD E K+LVVETTANQDPLVTK PTLVPLLGIDVWEHAYYLQYKNV+PDYLKNIW VMNWKYAS+VY KECP
Sbjct:   68 NKALEQLNDAIEKGDSAAVVKLQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGAALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYASEVYAKECP 231          
BLAST of CN185705 vs. ExPASy Swiss-Prot
Match: SODM_CAPAN (Superoxide dismutase [Mn], mitochondrial OS=Capsicum annuum GN=SODA PE=2 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 1.757e-66
Identity = 117/164 (71.34%), Postives = 133/164 (81.10%), Query Frame = -2
Query:  306 NKAVEQLFSSFEQSRHFHRRPVAGRYQVQRRGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP 797
            N A++QL  +  +        + G  +    GH+NHS+FWKNLAP  EGGGEPP  SLG AIDT+FGSLEA+IQKM+AEGAALQGSGWVWLGLD E KRLV+ETTANQDPLV K P LVPLLGIDVWEHAYYLQYKNVKPDYLKNIW V+NWKYA++VY+KECP
Sbjct:   65 NNALQQLHDAINKGDSPTVAKLQGAIKFNGGGHINHSVFWKNLAPTREGGGEPPKGSLGSAIDTNFGSLEAVIQKMNAEGAALQGSGWVWLGLDKELKRLVIETTANQDPLVIKGPNLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWKVINWKYAAEVYEKECP 228          
BLAST of CN185705 vs. ExPASy Swiss-Prot
Match: SODM_ARATH (Superoxide dismutase [Mn], mitochondrial OS=Arabidopsis thaliana GN=SODA PE=1 SV=2)

HSP 1 Score: 236.113 bits (601), Expect = 1.702e-61
Identity = 111/162 (68.52%), Postives = 129/162 (79.63%), Query Frame = -2
Query:  312 NKAVEQLFSSFEQSRHFHRRPVAGRYQVQRRGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKE 797
            N A+EQL  +  +        +    +    GHVNHSIFWKNLAP  EGGGEPP  SLG AID HFGSLE L++KMSAEGAA+QGSGWVWLGLD E K+LVV+TTANQDPLVTK  +LVPL+GIDVWEHAYYLQYKNV+P+YLKN+W V+NWKYAS+VY+KE
Sbjct:   68 NNALEQLDQAVNKGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKE 229          
BLAST of CN185705 vs. ExPASy Swiss-Prot
Match: SODM4_MAIZE (Superoxide dismutase [Mn] 3.4, mitochondrial OS=Zea mays GN=SODA.3 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.903e-61
Identity = 110/160 (68.75%), Postives = 126/160 (78.75%), Query Frame = -2
Query:  318 NKAVEQLFSSFEQSRHFHRRPVAGRYQVQRRGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 797
            NKA+EQL ++  +        + G  +    GHVNHSIFWKNL P+ EGGGEPPH  LGWAID  FGS EAL+++M+AEGAALQGSGWVWL LD E K+L VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:   70 NKALEQLDAAVAKGDASAVVQLQGAIKFNGGGHVNHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSFEALVKRMNAEGAALQGSGWVWLALDKEPKKLSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 229          
BLAST of CN185705 vs. ExPASy Swiss-Prot
Match: SODM1_MAIZE (Superoxide dismutase [Mn] 3.1, mitochondrial OS=Zea mays GN=SODA.4 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 6.467e-61
Identity = 109/160 (68.12%), Postives = 125/160 (78.12%), Query Frame = -2
Query:  318 NKAVEQLFSSFEQSRHFHRRPVAGRYQVQRRGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 797
            NKA+EQL ++  +        +    +    GHVNHSIFWKNL P+ EGGGEPPH  LGWAID  FGS EAL++KM+AEGAALQGSGWVWL LD E K++ VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:   72 NKALEQLETAVSKGDASAVVQLQAAIKFNGGGHVNHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSFEALVKKMNAEGAALQGSGWVWLALDKEAKKVSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 231          
BLAST of CN185705 vs. ExPASy Swiss-Prot
Match: SODM3_MAIZE (Superoxide dismutase [Mn] 3.3, mitochondrial OS=Zea mays GN=SODA.2 PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.882e-60
Identity = 108/160 (67.50%), Postives = 124/160 (77.50%), Query Frame = -2
Query:  318 NKAVEQLFSSFEQSRHFHRRPVAGRYQVQRRGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 797
            NKA+EQ+     +        + G  +    GHVNHSIFWKNL P+ EGGGEPPH  LGWAID  FGS EAL+++M+AEGAALQGSGWVWL LD E K++ VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:   70 NKALEQIDDVVVKGDDSAVVQLQGAIKFNGGGHVNHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSFEALVKRMNAEGAALQGSGWVWLALDKEAKKVSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 229          
BLAST of CN185705 vs. ExPASy Swiss-Prot
Match: SODM_ORYSJ (Superoxide dismutase [Mn], mitochondrial OS=Oryza sativa subsp. japonica GN=SODA PE=2 SV=2)

HSP 1 Score: 231.876 bits (590), Expect = 3.210e-60
Identity = 109/160 (68.12%), Postives = 124/160 (77.50%), Query Frame = -2
Query:  318 NKAVEQLFSSFEQSRHFHRRPVAGRYQVQRRGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ 797
            NKA+EQL ++  +        +    +    GHVNHSIFW NL P+ EGGG+PPH+ LGWAID  FGS EAL++KMSAEGAALQGSGWVWL LD E K+L VETTANQDPLVTK   LVPLLGIDVWEHAYYLQYKNV+PDYL NIW VMNWKYA +VY+
Sbjct:   68 NKALEQLDAAVAKGDAPAIVHLQSAIKFNGGGHVNHSIFWNNLKPISEGGGDPPHAKLGWAIDEDFGSFEALVKKMSAEGAALQGSGWVWLALDKEAKKLSVETTANQDPLVTKGANLVPLLGIDVWEHAYYLQYKNVRPDYLSNIWKVMNWKYAGEVYE 227          
BLAST of CN185705 vs. ExPASy Swiss-Prot
Match: SODM_PEA (Superoxide dismutase [Mn], mitochondrial OS=Pisum sativum GN=SODA PE=2 SV=2)

HSP 1 Score: 223.787 bits (569), Expect = 8.741e-58
Identity = 111/162 (68.52%), Postives = 128/162 (79.01%), Query Frame = -2
Query:  312 NKAVEQLFSSFEQSRHFHRRPVAGRYQVQRRGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKE 797
            NKA+EQL  +  ++       +    +    GH+NHSIFWKNLAPV EGGGEPP  SLGWAIDT+FGSLEALIQK++AEGAALQ     WLGLD + KRLVVETT  QDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYLKNIW V+NWK+AS+VY+KE
Sbjct:   77 NKALEQLHDAVAKADTSTTVKLQNAIKFNGGGHINHSIFWKNLAPVSEGGGEPPKESLGWAIDTNFGSLEALIQKINAEGAALQ-----WLGLDKDLKRLVVETT--QDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKHASEVYEKE 231          
The following BLAST results are available for this feature:
BLAST of CN185705 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 213
Match NameE-valueIdentityDescription
SODM_PRUPE4.182e-6873.78Superoxide dismutase [Mn], mitochondrial OS=Prunus... [more]
SODM_NICPL5.462e-6872.56Superoxide dismutase [Mn], mitochondrial OS=Nicoti... [more]
SODM_HEVBR7.134e-6875.00Superoxide dismutase [Mn], mitochondrial OS=Hevea ... [more]
SODM_CAPAN1.757e-6671.34Superoxide dismutase [Mn], mitochondrial OS=Capsic... [more]
SODM_ARATH1.702e-6168.52Superoxide dismutase [Mn], mitochondrial OS=Arabid... [more]
SODM4_MAIZE2.903e-6168.75Superoxide dismutase [Mn] 3.4, mitochondrial OS=Ze... [more]
SODM1_MAIZE6.467e-6168.13Superoxide dismutase [Mn] 3.1, mitochondrial OS=Ze... [more]
SODM3_MAIZE1.882e-6067.50Superoxide dismutase [Mn] 3.3, mitochondrial OS=Ze... [more]
SODM_ORYSJ3.210e-6068.13Superoxide dismutase [Mn], mitochondrial OS=Oryza ... [more]
SODM_PEA8.741e-5868.52Superoxide dismutase [Mn], mitochondrial OS=Pisum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001M01_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001M01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185705 ID=CN185705|Name=CN185705|organism=Citrus sinensis|type=EST|length=798bp
TTTTTTTTTTTTTTTTTGTTACGCCATTAAACAAATAGAAAATAGAACCC
TATTCATACATATTCACAGATCCGTGCACATAGTGAGATACAAAAAGAGC
ATAAACCCCAATATTATTTTGGATGTCACATAAGGGATACACAAGTAACA
CTCACTGCAAAAGAAAGGGTGTCTGTCATCAGTTGCAAATTATCGTTTTA
TTGTCACTTCAGCGTGAAAAGCTGCAAGGGTATTCGCCTCTTGAACCCAA
GAGAGAACCCAGATCAAACAAAGAACTCCATGCTCAAGGAAGAGCTCCAA
GCTTAAGGGCATTCTTTCTGATACACATCACTAGCATACTTCCAGTTCAT
TACGTTCCAAATGTTTTTCAGATAATCTGGTTTGACATTCTTGTACTGTA
GGTAGTATGCATGCTCCCAAACATCTATACCAAGCAAAGGAACCAGAGTT
GGGGCTTTAGTCACCAGTGGATCCTGATTTGCAGTAGTTTCAACCACAAG
CCTTTTAAACTCTGTATCTAAACCAAGCCACACCCATCCAGAGCCCTGCA
AAGCTGCACCCTCAGCACTCATCTTTTGTATCAATGCTTCCAGAGAACCA
AAATGCGTGTCAATAGCCCAACCAAGGGAACTATGTGGTGGCTCGCCACC
TCCTTCGTGAACAGGAGCAAGATTCTTCCAGAAAATTGAGTGGTTGACAT
GACCTCGCCGTTGAACTTGATAGCGCCCTGCAACTGGACGACGGTGGAAG
TGTCGACTTTGTTCAAAGCTTGAAAAAAGCTGCTCGACCGCCTTGTTG
back to top