CN185704

Overview
NameCN185704
Unique NameCN185704
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8436 contig Csv1_Contig8436:82..727. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185704 vs. ExPASy Swiss-Prot
Match: RH38_ORYSJ (DEAD-box ATP-dependent RNA helicase 38 OS=Oryza sativa subsp. japonica GN=Os03g0158200 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.004e-20
Identity = 51/78 (65.38%), Postives = 56/78 (71.79%), Query Frame = -3
Query:  417 QQQVNLIVNYDPPVKHGKHLEPDCEVYLHRIGRAGRFGRKGVVFNLLMDGDDMIIMEKIERYFDIKVTEVRN--SDED 644
            Q QVNL++NYD P+K G   EPD EVYLHRIGRAGRFGRKG VFNLL    D  +M KIE YF   V EVRN  S+ED
Sbjct:  416 QAQVNLVINYDMPIKFGTRDEPDYEVYLHRIGRAGRFGRKGAVFNLLCGETDNTVMRKIETYFQHNVPEVRNWQSEED 493          
BLAST of CN185704 vs. ExPASy Swiss-Prot
Match: RH38_ARATH (DEAD-box ATP-dependent RNA helicase 38 OS=Arabidopsis thaliana GN=RH38 PE=2 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 7.193e-19
Identity = 49/79 (62.03%), Postives = 62/79 (78.48%), Query Frame = -3
Query:  417 QQQVNLIVNYDPPVKHGKHLEPDCEVYLHRIGRAGRFGRKGVVFNLLM-DGDDMIIMEKIERYFDIKVTEVR--NSDED 644
            QQ+VNL+VNY+ P K+    EPD EVYLHR+GRAGRFGRKG VFNLL+ DG D  +MEKIE+YF+  V E++  NS+E+
Sbjct:  406 QQRVNLVVNYNLPTKYETG-EPDYEVYLHRVGRAGRFGRKGAVFNLLLDDGWDKEVMEKIEKYFEANVKEIKSWNSEEE 483          
BLAST of CN185704 vs. ExPASy Swiss-Prot
Match: DDX25_HUMAN (ATP-dependent RNA helicase DDX25 OS=Homo sapiens GN=DDX25 PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 2.927e-12
Identity = 34/75 (45.33%), Postives = 53/75 (70.67%), Query Frame = -3
Query:  417 QQVNLIVNYDPPVKHGKHLEPDCEVYLHRIGRAGRFGRKGVVFNLLMDGDDMIIMEKIERYFDIKVTEVRNSDED 641
            +QV ++VN+D PVK G+  EPD E YLHRIGR GRFG+KG+ FN++ + D++  + KI+ +F+  + ++   D D
Sbjct:  405 KQVTIVVNFDLPVKQGE--EPDYETYLHRIGRTGRFGKKGLAFNMI-EVDELPSLMKIQDHFNSSIKQLNAEDMD 476          
BLAST of CN185704 vs. ExPASy Swiss-Prot
Match: DBP5_USTMA (ATP-dependent RNA helicase DBP5 OS=Ustilago maydis GN=DBP5 PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.227e-11
Identity = 34/73 (46.58%), Postives = 44/73 (60.27%), Query Frame = -3
Query:  423 QQVNLIVNYDPPVKHGKHLEPDCEVYLHRIGRAGRFGRKGVVFNLLMDGDDMIIMEKIERYFDIKVTEVRNSD 641
            QQV L++NYD P+      E D E YLHRIGR GRFGRKGV  N + D      M++IE+    ++T V  +D
Sbjct:  369 QQVTLVINYDMPLTQTG--EADAETYLHRIGRTGRFGRKGVSINFVHDQQSWSYMDQIEKALKCQITRVATND 439          
BLAST of CN185704 vs. ExPASy Swiss-Prot
Match: DBP5_SCLS1 (ATP-dependent RNA helicase dbp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp5 PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.227e-11
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = -3
Query:  417 QQVNLIVNYDPPVKHGKHLEPDCEVYLHRIGRAGRFGRKGVVFNLLMDGDDMIIMEKIERYFDIKVTEVRNSDED 641
            Q V++++NYD P+K     EPD E YLHRIGR GRFGR GV  + + D      + KI  +++I + ++   D D
Sbjct:  375 QSVSMVINYDIPMKGRSDFEPDPETYLHRIGRTGRFGRVGVSISFVFDRKSYDALNKIAHHYNIDLIKLNQDDWD 449          
BLAST of CN185704 vs. ExPASy Swiss-Prot
Match: DDX25_RAT (ATP-dependent RNA helicase DDX25 OS=Rattus norvegicus GN=Ddx25 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 7.209e-11
Identity = 32/75 (42.67%), Postives = 51/75 (68.00%), Query Frame = -3
Query:  417 QQVNLIVNYDPPVKHGKHLEPDCEVYLHRIGRAGRFGRKGVVFNLLMDGDDMIIMEKIERYFDIKVTEVRNSDED 641
            +QV ++VN+D PV   +  EPD E YLHRIGR GRFG+KG+ FN++ + D + ++ KI+ +F+  + ++   D D
Sbjct:  405 KQVTIVVNFDLPVNQSE--EPDYETYLHRIGRTGRFGKKGLAFNMI-EVDKLPLLMKIQDHFNSSIKQLDPEDMD 476          
BLAST of CN185704 vs. ExPASy Swiss-Prot
Match: DDX25_MOUSE (ATP-dependent RNA helicase DDX25 OS=Mus musculus GN=Ddx25 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 7.209e-11
Identity = 32/75 (42.67%), Postives = 51/75 (68.00%), Query Frame = -3
Query:  417 QQVNLIVNYDPPVKHGKHLEPDCEVYLHRIGRAGRFGRKGVVFNLLMDGDDMIIMEKIERYFDIKVTEVRNSDED 641
            +QV ++VN+D PV   +  EPD E YLHRIGR GRFG+KG+ FN++ + D + ++ KI+ +F+  + ++   D D
Sbjct:  406 KQVTIVVNFDLPVNQSE--EPDYETYLHRIGRTGRFGKKGLAFNMI-EVDKLPLLMKIQDHFNSNIKQLDPEDMD 477          
BLAST of CN185704 vs. ExPASy Swiss-Prot
Match: DDX25_BOVIN (ATP-dependent RNA helicase DDX25 OS=Bos taurus GN=DDX25 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.209e-11
Identity = 32/75 (42.67%), Postives = 51/75 (68.00%), Query Frame = -3
Query:  417 QQVNLIVNYDPPVKHGKHLEPDCEVYLHRIGRAGRFGRKGVVFNLLMDGDDMIIMEKIERYFDIKVTEVRNSDED 641
            +QV ++VN+D PV   +  EPD E YLHRIGR GRFG+KG+ FN++ + D + ++ KI+ +F+  + ++   D D
Sbjct:  405 KQVTIVVNFDLPVNQAE--EPDYETYLHRIGRTGRFGKKGLAFNMI-EVDKLPLLMKIQDHFNSSIKQLDPEDMD 476          
The following BLAST results are available for this feature:
BLAST of CN185704 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
RH38_ORYSJ1.004e-2065.38DEAD-box ATP-dependent RNA helicase 38 OS=Oryza sa... [more]
RH38_ARATH7.193e-1962.03DEAD-box ATP-dependent RNA helicase 38 OS=Arabidop... [more]
DDX25_HUMAN2.927e-1245.33ATP-dependent RNA helicase DDX25 OS=Homo sapiens G... [more]
DBP5_USTMA4.227e-1146.58ATP-dependent RNA helicase DBP5 OS=Ustilago maydis... [more]
DBP5_SCLS14.227e-1141.33ATP-dependent RNA helicase dbp5 OS=Sclerotinia scl... [more]
DDX25_RAT7.209e-1142.67ATP-dependent RNA helicase DDX25 OS=Rattus norvegi... [more]
DDX25_MOUSE7.209e-1142.67ATP-dependent RNA helicase DDX25 OS=Mus musculus G... [more]
DDX25_BOVIN7.209e-1142.67ATP-dependent RNA helicase DDX25 OS=Bos taurus GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001L24_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001L24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185704 ID=CN185704|Name=CN185704|organism=Citrus sinensis|type=EST|length=646bp
TTTTTTTTTTTTTTTTTGTCTCAGCAAAGCCCCATAACTTTTTACTTCAT
ATTAAGTAAAATTTGAACCCATTTCTGTCATTAAGTACATGCTTGTGTGT
TTTCACAGGAACGAGAAAAAGCCTCCAAAACAATGCTACAAAACCGACGT
AAGCAGAGAAAAATAAAAAAAGATTACACAACATAACAATATTCAACCTC
CGCTTTTGTTTGATTTATGTATAAACTACTCAAACCACCAAAGGAGGAAA
AAAAAAAAAACCATAGTTACGTTGGAAAGGTTACACAAAGACACCAAAGG
AGATTGATCCAATTTCTTTCAGCTTTTGTAACAAACTATGCCGATATATT
AACTGATGTAGCCAAGACTAAGAAAAATCATCACAGCAAACCGGCTGCCT
TAAGTGCTGCCTTGAAGTCCTCGTCGCTGTTCCGGACCTCAGTTACTTTG
ATGTCAAAGTACCGTTCAATTTTTTCCATGATAATCATATCATCACCATC
CATCAACAAATTAAACACAACTCCTTTGCGGCCAAAGCGTCCTGCCCGGC
CAATTCTATGCAGGTATACTTCACAATCAGGCTCTAAATGTTTTCCATGT
TTCACCGGAGGATCATAATTTACAATAAGATTAACCTGCTGCTGAT
back to top