DC899994

Overview
NameDC899994
Unique NameDC899994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:431..1284. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: APG2_ARATH (GDSL esterase/lipase APG OS=Arabidopsis thaliana GN=APG PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 2.462e-85
Identity = 151/229 (65.94%), Postives = 185/229 (80.79%), Query Frame = 3
Query:   12 LNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 698
            LNHAI L QQ++Y++EY+SKL K+AGSK++ SIIK AI ++ +GS DF+QNYYVNPLL KVYT + Y S L++ FS+FIK +Y +GARK GVTSLPP GCLPAARTLFG+HE GCVSR+NTDAQ FNKK+++AA+ LQKQ  DLKIV+FDI+ P+YDLVQ+PSKSGF EA               LCNPKS GTCSNA+QYVFWDSVHPS+AAN+++A  LI QGF+LL
Sbjct:  124 LNHAIPLYQQVEYFKEYKSKLIKIAGSKKADSIIKGAICLLSAGSSDFVQNYYVNPLLYKVYTVDAYGSFLIDNFSTFIKQVYAVGARKIGVTSLPPTGCLPAARTLFGFHEKGCVSRLNTDAQNFNKKLNAAASKLQKQYSDLKIVVFDIYSPLYDLVQNPSKSGFTEATKGCCGTGTVETTSLLCNPKSFGTCSNATQYVFWDSVHPSEAANEILATALIGQGFSLL 352          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL73_ARATH (GDSL esterase/lipase At5g03820 OS=Arabidopsis thaliana GN=At5g03820 PE=3 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.404e-64
Identity = 115/234 (49.15%), Postives = 168/234 (71.79%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGY--HESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 698
            T+   +AI+L QQL+ Y+EYQ+K+  + GS+++  I   AI+++ +GS DFLQ+YY+NP+LN+++TP+QYS  L+  +S+F++N+Y LGARK GVT+LPPLGCLPAA TLFG   + + CV R+N DA  FN K+++ + NL   LP LK+V+FDI+ P+ ++  +P ++GF E+              FLCN +S GTCSNA+ YVFWD  HPS+AAN+VIA+ L+VQG  L+
Sbjct:  121 TAIFYNAITLNQQLKNYKEYQNKVTNIVGSERANKIFSGAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDRLMKPYSTFVQNLYDLGARKIGVTTLPPLGCLPAAITLFGETGNNNTCVERLNQDAVSFNTKLNNTSMNLTNNLPGLKLVVFDIYNPLLNMAMNPVENGFFES-RRACCGTGTVETSFLCNARSVGTCSNATNYVFWDGFHPSEAANRVIANNLLVQGIPLI 353          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL72_ARATH (GDSL esterase/lipase At5g03810 OS=Arabidopsis thaliana GN=At5g03810 PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.103e-64
Identity = 115/233 (49.36%), Postives = 167/233 (71.67%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 698
            T+   +AI+L+QQL+ Y+EYQ+K+  + G +++  I   AI+++ +GS DFLQ+YY+NP+LN+++TP+QYS  L+  +S+F++N+YGLGAR+ GVT+LPPLGCLPAA TLF G   + CV R+N DA  FN K+++ + NL   LP LK+V+FDI+ P+ ++V +P + GF E+              FLCN  S GTCSNA+ YVFWD  HPS+AAN+VIA+ L+VQG  L+
Sbjct:  121 TAIFYNAITLSQQLKNYKEYQNKVTNIVGKERANEIFSGAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDHLLRSYSTFVQNLYGLGARRIGVTTLPPLGCLPAAITLFGGVGNNMCVERLNQDAVSFNTKLNNTSINLTNNLPGLKLVVFDIYNPLLNMVINPVEYGFFES-RRACCGTGTMETSFLCNALSVGTCSNATNYVFWDGFHPSEAANRVIANNLLVQGIPLI 352          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL78_ARATH (GDSL esterase/lipase At5g22810 OS=Arabidopsis thaliana GN=At5g22810 PE=2 SV=2)

HSP 1 Score: 243.432 bits (620), Expect = 1.189e-63
Identity = 114/235 (48.51%), Postives = 169/235 (71.91%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSAS---IIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 698
            T+ L  AISL QQL++Y++Y S++ ++A S  +++   II + IYIV +GS DF+QNYY+NPLL +  +P+++S +L+  +SSFI+N+Y LGAR+ GVT+LPPLGCLPAA T+ G HE GC  ++N DA  FN K+++ + +L++ L  L +V+FDI++P+YDL   PS+ GF EA               LCNPKS GTC+NA++YVFWD  HP++AAN+++AD L+V G +L+
Sbjct:  111 TAKLYSAISLPQQLEHYKDYISRIQEIATSNNNSNASAIISNGIYIVSAGSSDFIQNYYINPLLYRDQSPDEFSDLLILSYSSFIQNLYSLGARRIGVTTLPPLGCLPAAITVVGPHEGGCSEKLNNDAISFNNKLNTTSQDLKRNLIGLNLVVFDIYQPLYDLATRPSEFGFAEA-RRACCGTGLLETSILCNPKSVGTCNNATEYVFWDGFHPTEAANKILADNLLVSGISLI 344          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL59_ARATH (GDSL esterase/lipase At3g53100 OS=Arabidopsis thaliana GN=At3g53100 PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 4.528e-55
Identity = 101/226 (44.69%), Postives = 149/226 (65.93%), Query Frame = 3
Query:   21 AISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 698
            +ISLT+QL YYR YQ+++ ++ G   +  +    I+I+ +GS DFLQNYY+NPLLN + TP+Q++ +L+  FS FI+N+Y LGAR+ GV SLPP+GCLPAA TLFG     CV R+N DA  FN K+ +    L  +   L++V F++++P  D++ +P+ +GF E               FLCN  S GTC NA+ YVFWD  HP++A N+++A +L+ QG +L+
Sbjct:  126 SISLTRQLSYYRAYQNRVTRMIGRGNARILFSRGIHILSAGSSDFLQNYYINPLLNILNTPDQFADILLRSFSEFIQNLYELGARRIGVISLPPMGCLPAAITLFGAGNKSCVERLNNDAIMFNTKLENTTRLLMNRHSGLRLVAFNVYQPFLDIITNPTDNGFFET-KRACCGTGTIETSFLCNSLSFGTCVNATGYVFWDGFHPTEAVNELLAGQLLGQGISLI 350          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL90_ARATH (GDSL esterase/lipase At5g42170 OS=Arabidopsis thaliana GN=At5g42160/At5g42170 PE=3 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 7.018e-40
Identity = 81/225 (36.00%), Postives = 131/225 (58.22%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            T+ L   +SL+ QL+ ++EY++KL  + G +++  ++K+++Y+V + S D    Y    +    Y    Y+  L +  S F+  +YGLGAR+ GV S  P+GC+PAARTL G  +  C  ++N  A+ FN K+S     L K+LPD ++V+ D+   + D++++P   GF E               FLCN  +P TC N+S Y+FWDS HP++ A Q+I D+L+
Sbjct:  141 TAKLVKVVSLSDQLKNFQEYKNKLKVIVGEEKANFLVKNSLYLVVASSNDIAHTYTARSIK---YNKTSYADYLADSASKFVSALYGLGARRIGVFSAVPVGCVPAARTLRGKLKRRCSEKLNEVARNFNAKISPTLEALGKELPDSRVVLIDVCDTLNDMIENPKNYGF-EVSNRGCCGTGLVEVLFLCNKINPFTCKNSSSYIFWDSYHPTEKAYQIIVDKLL 361          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL34_ARATH (GDSL esterase/lipase At2g04570 OS=Arabidopsis thaliana GN=At2g04570 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.324e-38
Identity = 80/229 (34.93%), Postives = 122/229 (53.28%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGF 689
            TS +   + L +QL+YY+EYQ+KL    G  +    I+ ++Y++  G+ DFL+NY+  P  +  Y+   Y   L  I   F+K ++GLGARK  +  LPP+GC+P  R         CV R N  A QFN K+      L K+LP   +V  + ++P   ++++PS  GF E               + C   +P TC+NA +YVFWDS HP+Q  N ++A+ L+   F
Sbjct:  119 TSDVLSVLPLWKQLEYYKEYQTKLKAYQGKDRGTETIESSLYLISIGTNDFLENYFAFPGRSSQYSVSLYQDFLAGIAKEFVKKLHGLGARKISLGGLPPMGCMPLERATNIGTGGECVGRYNDIAVQFNSKLDKMVEKLSKELPGSNLVFSNPYEPFMRIIKNPSSFGF-EVVGAACCATGMFEMGYGCQRNNPFTCTNADKYVFWDSFHPTQKTNHIMANALMNSTF 346          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL66_ARATH (GDSL esterase/lipase At4g26790 OS=Arabidopsis thaliana GN=At4g26790 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 9.486e-37
Identity = 72/225 (32.00%), Postives = 129/225 (57.33%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            TS +   + L ++++YY+EYQ++L    G +++  II +++Y++  G+ DFL+NYY+ P   + Y+  +Y   L+ I + F+ ++Y LGARK  ++ L P GCLP  RT   ++ S C+   N  A+ FN K+      L + L  +++V  + +  + +++  P   GF E               +LC+  +P TCS+AS+YVFWDS HP++  N ++A+ ++
Sbjct:  120 TSAVLSVMPLWKEVEYYKEYQTRLRSYLGEEKANEIISESLYLISIGTNDFLENYYLLPRKLRKYSVNEYQYFLIGIAADFVTDIYRLGARKMSLSGLSPFGCLPLERTTQLFYGSKCIEEYNIVARDFNIKMEEKVFQLNRDLNGIQLVFSNPYDLVSEIIYHPEAFGF-ENVRSACCGTGYYEMSYLCDKMNPFTCSDASKYVFWDSFHPTEKTNAIVANHVL 343          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL52_ARATH (GDSL esterase/lipase At3g14820 OS=Arabidopsis thaliana GN=At3g14820 PE=3 SV=2)

HSP 1 Score: 152.14 bits (383), Expect = 3.605e-36
Identity = 81/227 (35.68%), Postives = 133/227 (58.59%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQ 683
            TS L   +S++ QL+Y++EY +K+ +  G ++   I++ ++++V S S D  + Y+V  +    Y    Y+  LV + S FIK +  LGA+  G+ S  P+GCLPA RTLFG  E  C  ++N  A  FN K+SS+   L+K+LP  +++  D++  + D++++P+  GF  A               LCN  +P TCS+AS +VF+DS HPS+ A Q+I  +L+ +
Sbjct:  123 TSTLLSVVSMSDQLKYFQEYLAKIKQHFGEEKVKFILEKSVFLVVSSSNDLAETYWVRSV---EYDRNSYAEYLVELASEFIKELSELGAKNIGLFSGVPVGCLPAQRTLFGGFERKCYEKLNNMALHFNSKLSSSLDTLKKELPS-RLIFIDVYDTLLDIIKNPTNYGFKVADKGCCGTGKIELME-LCNKFTPFTCSDASTHVFFDSYHPSEKAYQIITHKLLAK 344          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL48_ARATH (GDSL esterase/lipase At2g42990 OS=Arabidopsis thaliana GN=At2g42990 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 8.030e-36
Identity = 75/215 (34.88%), Postives = 121/215 (56.28%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIAD 668
            I L ++++Y++EYQS L+   G +++A II++++YIV  G+ DFL+NYY  P     ++  QY   LV I   F+K++Y LGARK   T + P+GCLP  R         C    N  A  FN ++    T L ++L  +KI   + +  ++D+V  P+  G +E               FLC   +P TCS+A+++VFWD+ HP++  NQ+++D
Sbjct:  126 IPLWKEVEYFKEYQSNLSAYLGHRRAAKIIRESLYIVSIGTNDFLENYYTLPDRRSQFSISQYQDFLVEIAEVFLKDIYRLGARKMSFTGISPMGCLPLERVTNLDDPFSCARSYNDLAVDFNGRLRRLVTKLNRELTGIKIYFANPYDIMWDIVTKPNLYG-LEISSSACCGTGLFEMGFLCGQDNPLTCSDANKFVFWDAFHPTERTNQIVSD 339          
The following BLAST results are available for this feature:
BLAST of DC899994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
APG2_ARATH2.462e-8565.94GDSL esterase/lipase APG OS=Arabidopsis thaliana G... [more]
GDL73_ARATH1.404e-6449.15GDSL esterase/lipase At5g03820 OS=Arabidopsis thal... [more]
GDL72_ARATH9.103e-6449.36GDSL esterase/lipase At5g03810 OS=Arabidopsis thal... [more]
GDL78_ARATH1.189e-6348.51GDSL esterase/lipase At5g22810 OS=Arabidopsis thal... [more]
GDL59_ARATH4.528e-5544.69GDSL esterase/lipase At3g53100 OS=Arabidopsis thal... [more]
GDL90_ARATH7.018e-4036.00GDSL esterase/lipase At5g42170 OS=Arabidopsis thal... [more]
GDL34_ARATH1.324e-3834.93GDSL esterase/lipase At2g04570 OS=Arabidopsis thal... [more]
GDL66_ARATH9.486e-3732.00GDSL esterase/lipase At4g26790 OS=Arabidopsis thal... [more]
GDL52_ARATH3.605e-3635.68GDSL esterase/lipase At3g14820 OS=Arabidopsis thal... [more]
GDL48_ARATH8.030e-3634.88GDSL esterase/lipase At2g42990 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899994 VSS Citrus sinensis cDNA clone VS27Q05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899994 ID=DC899994|Name=DC899994|organism=Citrus sinensis|type=EST|length=854bp
GGACATCCTACTTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTAC
TATAGAGAGTACCAGAGTAAGCTAGCAAAGGTAGCCGGTAGCAAACAATC
AGCTTCCATAATCAAGGATGCGATATACATAGTGGGTTCTGGGAGTGGTG
ACTTTCTTCAGAATTACTATGTCAATCCTTTACTTAACAAAGTCTACACT
CCTGAGCAGTATAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAA
GAACATGTATGGATTGGGGGCAAGAAAATTTGGAGTGACTTCACTGCCAC
CATTGGGTTGCCTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGC
GGCTGTGTCTCTAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGT
CAGCTCCGCAGCAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTG
TGATTTTCGACATTTTCAAGCCAATCTATGACCTTGTCCAGTCCCCTTCA
AAATCTGGCTTCGTGGAGGCAACAAGAGGTTGCTGTGGAACAGGAACTGT
AGAAACAACTGTCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCA
ATGCCTCTCAGTATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCT
AATCAGGTTATTGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTG
AAGGGGATGTCAAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCT
TAATCTTCTTGGTGTCTGTGCTTCAGTTTATCAGCTTGTCTATACATCAT
TTTAAGATTTCCTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTT
TTGC
back to top