DC899993

Overview
NameDC899993
Unique NameDC899993
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length528
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: GUB2_HORVU (Lichenase-2 (Fragment) OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.854e-32
Identity = 69/126 (54.76%), Postives = 89/126 (70.63%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIYP 383
            + + YALF +   VVRDG Y Y NLFD  VDAF++A+ K    +V L +SESGWPS G    T   NA+ YN++L++HV  G+GTPR PG   +T++F MFNENQK +GVEQN+G FYPNMQ +YP
Sbjct:  188 MDMGYALFNASGTVVRDGAYGYQNLFDTTVDAFYTAMGKHGGSSVKLVVSESGWPSGGGTAATP-ANARFYNQHLINHV--GRGTPRHPG-AIETYIFAMFNENQKDSGVEQNWGLFYPNMQHVYP 309          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_PEA (Glucan endo-1,3-beta-glucosidase OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.255e-29
Identity = 69/127 (54.33%), Postives = 87/127 (68.50%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIYPF 386
            ISL YALF S   +V+DGP  Y NLFDAM+D+ H+AL+   +  V + +SESGWPS G    TS +NA+ Y  NL+ HV  GKGTPRRP  T + +LF MF+ENQK   +E++FG FYPN Q  YPF
Sbjct:  222 ISLPYALFTSPGVMVQDGPNGYQNLFDAMLDSVHAALDNTGIGWVNVVVSESGWPSDGGSA-TSYDNARIYLDNLIRHV--GKGTPRRPWAT-EAYLFAMFDENQKSPELEKHFGVFYPNKQKKYPF 344          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13E_HORVU (Glucan endo-1,3-beta-glucosidase GV OS=Hordeum vulgare PE=2 SV=2)

HSP 1 Score: 127.872 bits (320), Expect = 2.945e-29
Identity = 68/129 (52.71%), Postives = 90/129 (69.77%), Query Frame = 3
Query:    3 HISLDYALFQSKDPVVRDGPYLYY-NLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAG-VEQNFGFFYPNMQPIYP 383
            +I L+YA  Q    V  +G  L Y +LFDAMVD+ ++ALEK   PNV + +SESGWPSAG     S+ENA+ YN+ L+DH+    GTP+RPG   +T++F MFNEN+KP   VE+NFG F+PN QP+YP
Sbjct:  187 NIRLNYATLQPGTTVRDNGNGLTYTSLFDAMVDSIYAALEKAGTPNVRVVVSESGWPSAGGFG-ASVENARNYNQGLIDHI--RSGTPKRPG-AIETYIFAMFNENRKPGDEVERNFGLFFPNKQPVYP 311          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13H_TOBAC (Glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q' OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 6.560e-29
Identity = 63/125 (50.40%), Postives = 86/125 (68.80%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            I L+YALF S + VV D    Y NLFDA++DA +SALEK    ++ + +SESGWPSAG    TSI+NA+ YN NL+ HV G  G+P+RP    +T++F +F+E+QK   +E++FG F  NMQP Y
Sbjct:  212 IKLEYALFTSSEVVVNDNGRGYRNLFDAILDATYSALEKASGSSLEIVVSESGWPSAGAGQLTSIDNARTYNNNLISHVKG--GSPKRPSGPIETYVFALFDEDQKDPEIEKHFGLFSANMQPKY 334          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_MAIZE (Glucan endo-1,3-beta-glucosidase, acidic isoform OS=Zea mays PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.493e-28
Identity = 69/128 (53.91%), Postives = 89/128 (69.53%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEK-IDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKP-AGVEQNFGFFYPNMQPIYP 383
            I L YALF S   VV+DG   Y NLFDA+VD F SALE+     NV + +SESGWPSAG +  T+  NAQ YN+NL++HV  G+GTP+RPG   +T++F MFNE+QK  A  E++FG F P+  P+YP
Sbjct:  208 IDLKYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALEENAGAGNVPVVVSESGWPSAGGDAATA-ANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKTGAESERHFGLFNPDKSPVYP 331          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13F_HORVU (Putative glucan endo-1,3-beta-glucosidase GVI (Fragment) OS=Hordeum vulgare PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.616e-27
Identity = 67/139 (48.20%), Postives = 87/139 (62.59%), Query Frame = 3
Query:    6 ISLDYALFQSKDPV-VRDGPYLYYNLFDAMVDAFHSALEKIDV-PNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIYPFWPC*KHLSFT 416
            + LDYAL  S   V V D    Y N+FDA++DA ++A+EK     ++ L +SE+GWPS G     S+ENA  Y  NL+ HV    GTPRRPG+  +T++F MFNENQKP GVEQNFG F P+M  +Y       H+ FT
Sbjct:  189 VRLDYALLSSSAAVAVTDNGVEYANMFDAILDAVYAAVEKAGGGESLELVVSETGWPSGGGGYGASVENAAAYINNLVRHV---GGTPRRPGKAVETYIFAMFNENQKPEGVEQNFGMFQPDMSQVY-------HVDFT 317          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13D_HORVU (Glucan endo-1,3-beta-glucosidase GIV OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.110e-27
Identity = 66/128 (51.56%), Postives = 86/128 (67.19%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGP--YLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPA-GVEQNFGFFYPNMQPIY 380
            I L+YA FQ     VRD     +Y NLF+AMVDA ++ALEK   P+V + +SESGWPSAG    T  ENA+ YN+ L+DHV    GTP++PG   + ++F MFNENQKP    E++FG FYPN +P+Y
Sbjct:  181 IKLNYATFQPGATPVRDAGNGLIYTNLFNAMVDAMYAALEKAGAPSVRVVVSESGWPSAGGFAATP-ENARAYNQGLIDHV--AHGTPKKPGH-MEAYVFAMFNENQKPGLETERHFGLFYPNKRPVY 304          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13D_TOBAC (Glucan endo-1,3-beta-glucosidase OS=Nicotiana tabacum GN=SP41B PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.600e-27
Identity = 61/126 (48.41%), Postives = 84/126 (66.67%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            + L YALF  ++         Y NLFDA++D+ + A+EK   PNV + +SESGWPS GN   T IENAQ Y +NL++HV GG GTP++PG+  +T+LF MF+EN+K   + E++FG FYPN    Y
Sbjct:  222 VPLSYALFNQQETNSTG----YQNLFDALLDSIYFAVEKAGGPNVEIIVSESGWPSEGNSAAT-IENAQTYYRNLVNHVKGGAGTPKKPGRIIETYLFAMFDENEKQGEITEKHFGLFYPNRAAKY 342          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: GUB_NICPL (Lichenase OS=Nicotiana plumbaginifolia GN=GN1 PE=2 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 6.140e-27
Identity = 63/126 (50.00%), Postives = 84/126 (66.67%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIYP 383
            ISL YALF + + VV+DG   Y NLFDAM DA ++AL +    ++ + +SESGWPSAG    T+  NA  Y KNL+ HV   +G+PRRP +  +T+LF MF+EN K   +E++FG F PN QP YP
Sbjct:  221 ISLPYALFTAPNVVVQDGSLGYRNLFDAMSDAVYAALSRAGGGSIEIVVSESGWPSAGAFAATT-NNAATYYKNLIQHV--KRGSPRRPNKVIETYLFAMFDENNKNPELEKHFGLFSPNKQPKYP 343          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13J_TOBAC (Glucan endo-1,3-beta-glucosidase, acidic isoform PR-O (Fragment) OS=Nicotiana tabacum GN=PR0 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 8.019e-27
Identity = 61/126 (48.41%), Postives = 84/126 (66.67%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            + L YALF  ++      P  Y NLFDA++D+ + A+EK   PNV + +SESGWPS GN   T IENAQ Y +NL+DHV  G GTP++PG+T +T+LF MF+EN K   + E++FG F P+ +  Y
Sbjct:   35 VPLSYALFTQQEA----NPAGYQNLFDALLDSMYFAVEKAGGPNVEIIVSESGWPSEGNSAAT-IENAQTYYRNLIDHVKRGAGTPKKPGKTIETYLFAMFDENDKKGEITEKHFGLFSPDQRAKY 155          
The following BLAST results are available for this feature:
BLAST of DC899993 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
GUB2_HORVU4.854e-3254.76Lichenase-2 (Fragment) OS=Hordeum vulgare PE=1 SV=... [more]
E13B_PEA2.255e-2954.33Glucan endo-1,3-beta-glucosidase OS=Pisum sativum ... [more]
E13E_HORVU2.945e-2952.71Glucan endo-1,3-beta-glucosidase GV OS=Hordeum vul... [more]
E13H_TOBAC6.560e-2950.40Glucan endo-1,3-beta-glucosidase, acidic isoform P... [more]
E13B_MAIZE2.493e-2853.91Glucan endo-1,3-beta-glucosidase, acidic isoform O... [more]
E13F_HORVU1.616e-2748.20Putative glucan endo-1,3-beta-glucosidase GVI (Fra... [more]
E13D_HORVU2.110e-2751.56Glucan endo-1,3-beta-glucosidase GIV OS=Hordeum vu... [more]
E13D_TOBAC3.600e-2748.41Glucan endo-1,3-beta-glucosidase OS=Nicotiana taba... [more]
GUB_NICPL6.140e-2750.00Lichenase OS=Nicotiana plumbaginifolia GN=GN1 PE=2... [more]
E13J_TOBAC8.019e-2748.41Glucan endo-1,3-beta-glucosidase, acidic isoform P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899993 VSS Citrus sinensis cDNA clone VS27Q04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899993 ID=DC899993|Name=DC899993|organism=Citrus sinensis|type=EST|length=528bp
CTCACATATCCTTAGACTATGCCTTATTTCAGTCGAAAGATCCTGTAGTT
AGAGACGGGCCATACTTGTATTATAATCTATTTGATGCCATGGTTGATGC
TTTTCACTCAGCTCTGGAGAAGATTGATGTACCGAATGTGACTTTGGCCA
TATCAGAGTCAGGATGGCCTAGTGCTGGCAATGAGCCTTATACAAGCATA
GAAAATGCACAAAAATATAATAAGAACTTGATGGATCATGTCTTGGGAGG
AAAAGGGACTCCGAGGAGGCCAGGTCAAACTTTTGATACATTTTTATTTG
AGATGTTCAATGAGAATCAAAAGCCTGCTGGGGTTGAGCAGAATTTCGGA
TTCTTCTATCCAAATATGCAGCCAATTTATCCATTTTGGCCATGCTAGAA
GCATTTATCTTTTACTTATACTGCTGTAATGTAAGCGTGGTGCCTAATTT
GAAAAAGTAACTTATGAAGCAAGTTACACCTTTGCTTTTGCTAAGTAATA
AAAGAATAGATAGTANTTAATTAAAAAA
back to top