CN185702

Overview
NameCN185702
Unique NameCN185702
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length766
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2501 contig Csv1_Contig2501:1..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185702 vs. ExPASy Swiss-Prot
Match: ATL5H_ARATH (RING-H2 finger protein ATL5H OS=Arabidopsis thaliana GN=ATL5H PE=2 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 4.237e-30
Identity = 82/224 (36.61%), Postives = 110/224 (49.11%), Query Frame = -3
Query:  102 ETLRLLPKCDHVFHPHCIDVWLASHVTCPVCRANLTPESNKKVKLCDSNNESNQTHNNSASELSGEQSRAVIDINDEQSNSDAQVLEITNAASHVTPMRNRPPRLGMPERFPRSHSTGHSLVLAGVSVERYTLRFPDEVRKKLMTRGKLKRTASFNAALAMXXXXXXXXXXXXXXXXRNYVDRQIGRSDRWVFSMTPPFVSKM---GFVKVGGEGMGLGDGWNS 764
            ETLRLLPKCDHVFHPHCI  WL  HVTCPVCR NL  ++ +   + +++ E+ Q                       QS     V+E+              PR+    +FPRSH+TGHS+VL G S +R+TLR P+E+RKK+M   KL R+ S                          VDR   +SDRW+F  TP F+ +    G +++GG G   G+   S
Sbjct:  135 ETLRLLPKCDHVFHPHCIGAWLQGHVTCPVCRTNLAEQTPEPEVVVETDLEAQQ-----------------------QSAVPVPVVEL--------------PRV----KFPRSHTTGHSVVLPGESTDRFTLRVPEELRKKIMANWKLNRSNS-----------VFVLPRGGSSRSGKQVDRSRAKSDRWLFRKTPSFLWRNRDDGSIRLGGTGSVRGNSVTS 306          
BLAST of CN185702 vs. ExPASy Swiss-Prot
Match: ATL3B_ARATH (RING-H2 finger protein ATL3B OS=Arabidopsis thaliana GN=ATL3B PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 2.325e-28
Identity = 80/220 (36.36%), Postives = 109/220 (49.55%), Query Frame = -3
Query:  129 ETLRLLPKCDHVFHPHCIDVWLASHVTCPVCRANLTPESNKKVKLCDSNNESNQTHNNSASELSGEQSRAVIDINDEQSNSDAQVLEITNAASHVTPMRNRPPRLGMP-----ERFPRSHSTGHSLVLAGVSVERYTLRFPDEVRKKLMTRGKLKRTASFNAALAMXXXXXXXXXXXXXXXXRNYVDRQIGRSDRWVFSMTPPFVSKM---GFVKVGGEG 764
            ETLRLLPKCDHVFHPHCID WL +HVTCPVCRANL  +               ++     +E   E  + V++     +    + L  +   S   P        G+P      +F RSH+TGHS+V  G   ER+TLR P++VRK++M   KL RT   N+ L +                   +DR   RSDRW+F  TP F+ +    G +++G  G
Sbjct:  139 ETLRLLPKCDHVFHPHCIDAWLEAHVTCPVCRANLAEQV-----------AEGESVEPGGTEPDLELQQVVVNPEPVVTAPVPEQLVTSEVDSRRLP--------GVPVDLKRVKFSRSHTTGHSVVQPGECTERFTLRLPEDVRKRIMKDWKLNRT---NSLLVLPRGGSSRRGKP--------IDRSRARSDRWLFRKTPSFLWRSRDDGSIRLGATG 328          
BLAST of CN185702 vs. ExPASy Swiss-Prot
Match: ATL2G_ARATH (RING-H2 finger protein ATL2G OS=Arabidopsis thaliana GN=ATL2G PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.252e-22
Identity = 66/164 (40.24%), Postives = 97/164 (59.15%), Query Frame = -3
Query:  288 ETLRLLPKCDHVFHPHCIDVWLASHVTCPVCRANLTPESNKKVKLCDSNNESNQTHNNSASELSGEQSRAVIDINDEQSNSDAQVLE-ITNAASHVTPMRNRPPRLGMPE----RFPRSHSTGHSLVLAGVSVERYTLRFPDEVRKKLMTRGKLKRTASFNAAL 764
            ETLRL+P C HVFH  C+DVWL+ H TCP+CRA+L    N++    DS    + T   + S  +  +   V++      +SDA +L+ +T + S++TP R++   L   +     FPRSHSTGHSL+    +++R+TLR PD+VR++LM   K  RT    A L
Sbjct:  146 ETLRLMPPCCHVFHADCVDVWLSEHSTCPLCRADLV--LNQQGDDDDSTESYSGTDPGTISSSTDPERGMVLE------SSDAHLLDAVTWSNSNITP-RSKSTGLSSWQITGILFPRSHSTGHSLIQPAGNLDRFTLRLPDDVRRQLM---KTSRTMGHVALL 297          
BLAST of CN185702 vs. ExPASy Swiss-Prot
Match: ATL4O_ARATH (RING-H2 finger protein ATL4O OS=Arabidopsis thaliana GN=ATL4O PE=2 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 3.595e-21
Identity = 65/161 (40.37%), Postives = 89/161 (55.28%), Query Frame = -3
Query:  288 ETLRLLPKCDHVFHPHCIDVWLASHVTCPVCRANLTPESNKKVKLCDSNNESNQTHNNSASELSGEQSRAVIDINDEQSNSDAQVLEITNAASHVTPMRNRPPRLGMPERFPRSHSTGHSLVLAGVSVERYTLRFPDEVRKKLM-TRG-KLKRTASFNAAL 764
            ET+RLLP C+H+FH  CID WL SH TCPVCR+NLT +SNK                +    L+  +   V+DI         + +E+  A SH     +R     +  +FPRS+STGHS+       ER+TLR PD+V+ +LM  +G +LKRT SF+  L
Sbjct:  134 ETVRLLPICNHLFHIDCIDTWLYSHATCPVCRSNLTAKSNK------------PGDEDDGVPLAAMRDHVVVDI---------ETVEV--AKSH-----HRRLSSEISGKFPRSNSTGHSMDRFSDGTERFTLRLPDDVKMRLMAVKGRRLKRTRSFDVDL 266          
BLAST of CN185702 vs. ExPASy Swiss-Prot
Match: ATL1N_ARATH (RING-H2 finger protein ATL1N OS=Arabidopsis thaliana GN=ATL1N PE=2 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 8.009e-21
Identity = 82/257 (31.91%), Postives = 125/257 (48.64%), Query Frame = -3
Query:   18 ETLRLLPKCDHVFHPHCIDVWLASHVTCPVCRANLTPESNKKVKLCDSNNESNQTHNNSASELSGEQSRAVIDINDEQSNSDAQVLE-ITNAASHVTPMRNRPPRLGMPERFPRSHSTGHSLVLAGVSVERYTLRFPDEVRKKLMTRGKLKRTASFNAALAMXXXXXXXXXXXXXXXXRN--YVDR--QIGRSDRWVFSMTPPF-VSKMGFVKVGGEGMGLGDGWN-SNGRNLLTAVKSPLNCLNV-KIGQGGESSS 764
            ETLRL+PKC HVFHP CID WL SH TCP+CRA+L P   + +    S       ++   S+ +G++ R++        + DA+++E +    +   P R+      +   F  S  TG        +++R+TLR P ++  KL+        +  + AL                  RN  Y +R  Q GR DR  FS+TPP+  S +  +  GG G   GD    S+ ++LL A++SP + L + K    GE+SS
Sbjct:  155 ETLRLIPKCCHVFHPGCIDAWLRSHTTCPLCRADLIPVPGESIV---SIQIPGLVNDPPGSDPNGDRIRSL-------GSPDARLIESVALTCNQSMPRRSMSTGWNLAGMFTNSDRTGQH----SENLDRFTLRLPQDIHNKLVN----PNLSKVHVALPQVMSSTRGYRTGSLGSERNYFYYERFDQDGRLDRRPFSITPPYRTSSINHMSPGGSG---GDKVRASSPKSLLLAMRSPFDRLFLGKNNNVGENSS 390          
BLAST of CN185702 vs. ExPASy Swiss-Prot
Match: ATL4D_ARATH (Putative RING-H2 finger protein ATL4D OS=Arabidopsis thaliana GN=ATL4D PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.366e-20
Identity = 62/157 (39.49%), Postives = 91/157 (57.96%), Query Frame = -3
Query:  309 ETLRLLPKCDHVFHPHCIDVWLASHVTCPVCRANLTPESNKKVKLCDSNNESNQTHNNSASELSGEQSRAVIDINDEQSNSDAQVLEITNAASHVTPMRNRPPRL----GMPERF-PRSHSTGHSLVLAGVSVERYTLRFPDEVRKKLMTRGKLKRT 764
            E LR +P C H FH +CID WL+S  TCPVCRANL+ +S             +   + S    +G   R V +  DE+S + + V    N A++ TP R+R   L     +PE F PRSHSTGHSLV    +++R+TL+ P+EV+++L++   +KR+
Sbjct:  131 EPLRWMPPCSHTFHANCIDEWLSSRSTCPVCRANLSLKS------------GDSFPHPSMDVETGNAQRGVQESPDERSLTGSSV-TCNNNANYTTP-RSRSTGLLSSWHVPELFLPRSHSTGHSLVQPCQNIDRFTLQLPEEVQRQLVSLNLIKRS 273          
BLAST of CN185702 vs. ExPASy Swiss-Prot
Match: ATL1H_ARATH (RING-H2 finger protein ATL1H OS=Arabidopsis thaliana GN=ATL1H PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 8.855e-20
Identity = 60/149 (40.27%), Postives = 82/149 (55.03%), Query Frame = -3
Query:  336 ETLRLLPKCDHVFHPHCIDVWLASHVTCPVCRANLTPESNKKVKLCDSNN--ESNQTHNNSASELSGEQSRAVIDINDEQSNSDAQVLEITNAASHVTPMRNRPPRLG----MPERFPRSHSTGHSLVLAGVSVERYTLRFPDEVRKKL 764
            ETLRL+P C H FH  CIDVWL+S  TCPVCRA+L P+        D N+     + H+N   +L    +R  +  + +    D   L  +N     TP R+R   L         FPRSHSTGHSLV    +++R+TL+ P+EVR++L
Sbjct:  139 ETLRLMPPCSHAFHASCIDVWLSSRSTCPVCRASLPPKPGS-----DQNSLYPFIRPHDNQDMDLENVTARRSVLESPDVRLLDR--LSWSNNTGANTPPRSRSTGLSNWRITELLFPRSHSTGHSLVPRVENLDRFTLQLPEEVRRQL 280          
BLAST of CN185702 vs. ExPASy Swiss-Prot
Match: ATL1C_ARATH (RING-H2 finger protein ATL1C OS=Arabidopsis thaliana GN=ATL1C PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.859e-18
Identity = 72/255 (28.24%), Postives = 113/255 (44.31%), Query Frame = -3
Query:   21 ETLRLLPKCDHVFHPHCIDVWLASHVTCPVCRANLTPESNKKVKLCDSNNESNQTHNNSASELSGEQSRAVIDINDEQSNSDAQVLEITNAASHVTPMRNRPPRLGMPERFPRSHSTGHSLVLAGVSVERYTLRFPDEVRKKLMTRGKLKRTASFNAALAMXXXXXXXXXXXXXXXXRN--YVDR--QIGRSDRWVFSMTPPFVSKMGFVKVGGEGMGLGDGWNSNG---RNLLTAVKSPLNCLNVKIGQGGESS 764
            ETLRL+P+C HVFHP CID WL S  TCP+CRANL P   + V   +    + +T  NS      +  + V+   DE+      +  +    +   P ++      + E +  + S G        +++RYTLR P E+  +L+     K+ +    AL                  +N  Y +R  Q GR DR  FS+TPP+ ++   ++   E +     +       + LL A++SP + L       GE S
Sbjct:  129 ETLRLIPQCCHVFHPGCIDAWLRSQTTCPLCRANLVPVPGESVS-SEIPGLARETGQNSLRTPIDDNRKRVLTSPDER-----LIDSVAWTGNQSMPRKSMSTGWKLAELYSPASSPGQ----PEENLDRYTLRLPQEIHDQLVNSSLGKQGSKGQLALPQERSSVRGFRTGSLGTEKNYFYFERFDQDGRLDRRPFSITPPYHTRS--IQSPDEIINASGNYQDRAGAPKGLLLAIRSPFDRLFTGKKNAGERS 371          
BLAST of CN185702 vs. ExPASy Swiss-Prot
Match: ATL4C_ARATH (Putative RING-H2 finger protein ATL4C OS=Arabidopsis thaliana GN=ATL4C PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 7.016e-17
Identity = 56/154 (36.36%), Postives = 86/154 (55.84%), Query Frame = -3
Query:  309 ETLRLLPKCDHVFHPHCIDVWLASHVTCPVCRANLTPESNKKVKLCDSNNESNQTHNNSASELSGEQSRAVIDINDEQSNSDAQVLEITNAASHVTPMRNRPPRLGMPERF-PRSHSTGHSLV-LAGVSVERYTLRFPDEVRKKLMTRGKLKRT 764
            ETLR +P C H FH +CIDVWL+S  TCPVCRANL+ +  +           +  + N   E  G Q      + +E+S +   V   + +   ++  R       M E F PRSHSTGHSLV   G +++R+TL+ P+EV+++L++   ++R+
Sbjct:  134 ETLRWMPPCSHTFHANCIDVWLSSWSTCPVCRANLSLKPGE-----------SYPYLNMDVETGGVQK-----LPNERSLTGNSVTTRSRSTGLLSSWR-------MAEIFVPRSHSTGHSLVQQLGENLDRFTLQLPEEVQRQLVSLNLIRRS 264          
BLAST of CN185702 vs. ExPASy Swiss-Prot
Match: ATL5L_ARATH (Putative RING-H2 finger protein ATL5L OS=Arabidopsis thaliana GN=ATL5L PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.939e-16
Identity = 52/153 (33.99%), Postives = 74/153 (48.37%), Query Frame = -3
Query:  303 LRLLPKCDHVFHPHCIDVWLASHVTCPVCRANLTPESNKKVKLCDSNNESNQTHNNSASELSGEQSRAVIDINDEQSNSDAQVLEITNAASHVTPMRNRPPRLGMPERFPRSHSTGHSLVLAGVSVE-RYTLRFPDEVRKKLMTRGKLKRTAS 758
            LRLL  C HVFH  CID WL S+ TCPVCR NL P + + +K           H N   E +   +  +  ++ + S ++ + +E                   +P++F RS +TGHS+V      E RYTLR PD V+ K+  R    +T S
Sbjct:  128 LRLLTTCYHVFHQECIDQWLESNKTCPVCRRNLDPNAPENIKELIIEVIQENAHENRDQEQTSTSNEVM--LSRQSSGNNERKIET------------------LPDKFSRSKTTGHSIVRNKPEEEDRYTLRLPDHVKIKVTRRHNNNQTES 260          
The following BLAST results are available for this feature:
BLAST of CN185702 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
ATL5H_ARATH4.237e-3036.61RING-H2 finger protein ATL5H OS=Arabidopsis thalia... [more]
ATL3B_ARATH2.325e-2836.36RING-H2 finger protein ATL3B OS=Arabidopsis thalia... [more]
ATL2G_ARATH3.252e-2240.24RING-H2 finger protein ATL2G OS=Arabidopsis thalia... [more]
ATL4O_ARATH3.595e-2140.37RING-H2 finger protein ATL4O OS=Arabidopsis thalia... [more]
ATL1N_ARATH8.009e-2131.91RING-H2 finger protein ATL1N OS=Arabidopsis thalia... [more]
ATL4D_ARATH1.366e-2039.49Putative RING-H2 finger protein ATL4D OS=Arabidops... [more]
ATL1H_ARATH8.855e-2040.27RING-H2 finger protein ATL1H OS=Arabidopsis thalia... [more]
ATL1C_ARATH4.859e-1828.24RING-H2 finger protein ATL1C OS=Arabidopsis thalia... [more]
ATL4C_ARATH7.016e-1736.36Putative RING-H2 finger protein ATL4C OS=Arabidops... [more]
ATL5L_ARATH5.939e-1633.99Putative RING-H2 finger protein ATL5L OS=Arabidops... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001L23_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001L23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185702 ID=CN185702|Name=CN185702|organism=Citrus sinensis|type=EST|length=766bp
GAGGCCTGGGGCCTTGCCGAGGAGGATTCGCCACCTTGCCCAATCTTCAC
GTTAAGACAATTTAACGGCGATTTAACTGCTGTCAACAGGTTCCTTCCGT
TCGAATTCCAACCATCGCCCAATCCCATACCCTCACCACCAACTTTAACG
AACCCCATCTTCGAAACAAACGGCGGAGTCATTGAAAAAACCCAGCGGTC
GGACCGGCCAATTTGCCGGTCCACATAATTTCTTCCTCTACTACTCCCTT
CTCCTCCACCACCCTTTCTGGAACTGCCTTCCATTGCCAGAGCGGCATTG
AAACTCGCCGTTCGCTTAAGTTTACCTCTCGTCATTAGCTTTTTCCTAAC
CTCGTCTGGAAATCTTAGTGTGTACCTCTCAACGCTTACTCCAGCTAGAA
CAAGCGAATGTCCTGTCGAATGTGACCTCGGAAACCTCTCTGGCATTCCC
AATCTCGGCGGTCGGTTCCTCATCGGCGTCACGTGACTCGCCGCGTTAGT
AATTTCAAGCACTTGCGCGTCACTGTTGCTTTGCTCGTCGTTGATGTCGA
TCACAGCGCGACTTTGCTCTCCACTGAGTTCAGAAGCGGAGTTGTTGTGA
GTCTGATTCGACTCGTTGTTTGAATCGCATAATTTAACCTTTTTGTTTGA
TTCTGGAGTAAGGTTGGCCCTACAAACCGGGCACGTCACGTGAGAGGCTA
ACCAGACATCGATGCAATGAGGATGGAACACGTGATCACATTTTGGAAGT
AAACGCAGCGTTTCGT
back to top