CN185700

Overview
NameCN185700
Unique NameCN185700
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length694
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN185700_ssr1 microsatellite CN185700_ssr1:1..12. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4219 contig Csv1_Contig4219:29..722. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185700 vs. ExPASy Swiss-Prot
Match: PME3_PHAVU (Pectinesterase 3 OS=Phaseolus vulgaris GN=MPE3 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.354e-21
Identity = 63/175 (36.00%), Postives = 95/175 (54.29%), Query Frame = -3
Query:  195 AESIKTVCSVTQNPDSCFXXXXXXXXXXXXXTKPDPEVILKLSLQVNVNHFSNITSSIKSLYGN--HLEVALRDCVDQLRDASSRLNDSMSELNATL----TDRTVNDIQTWISAAMTDEETCLDGLEEMGSTVA----DEVKTMMKKSKELLSYSLAIIANIRTLLQKFGLHMH 689
            A S+K VC  T+ P SCF                DPE++ KLSL+V ++  S+  S +++       L+ A+  C     DA  RLNDS+S L        +  +V++++TW+SAA+TD++TCLD + E+ ST A     E++T M+ S E  S SLAI+  I  LL +F   +H
Sbjct:   74 AASLKAVCDTTRYPSSCFSSISSLPESNTT----DPELLFKLSLRVAIDELSSFPSKLRANAEQDARLQKAIDVCSSVFGDALDRLNDSISALGTVAGRIASSASVSNVETWLSAALTDQDTCLDAVGELNSTAARGALQEIETAMRNSTEFASNSLAIVTKILGLLSRFETPIH 244          
BLAST of CN185700 vs. ExPASy Swiss-Prot
Match: PME1_ARATH (Pectinesterase 1 OS=Arabidopsis thaliana GN=PME1 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.769e-21
Identity = 62/180 (34.44%), Postives = 95/180 (52.78%), Query Frame = -3
Query:  195 SIKTVCSVTQNPDSCFXXXXXXXXXXXXXTKPDPEVILKLSLQVNVNHFSNITSSIKSLY----GNHLEVALRDCVDQLRDASSRLNDSMS-----ELNATLTDRTVNDIQTWISAAMTDEETCLDGLEEM--------GSTVADEVKTMMKKSKELLSYSLAIIANIRTLLQKFGLHMH 683
            S+K +CSVT+ P+SC                 DPE + KLSL+V ++   +I+   + L        ++ ALR C D + DA  RLND++S     E   TL+   + D++TW+SA +TD ETC D L+E+         ST+   +K+ M +S E  S SLAI++ I + L   G+ +H
Sbjct:   72 SLKAICSVTRFPESCISSISKLPSSNTT----DPETLFKLSLKVIIDELDSISDLPEKLSKETEDERIKSALRVCGDLIEDALDRLNDTVSAIDDEEKKKTLSSSKIEDLKTWLSATVTDHETCFDSLDELKQNKTEYANSTITQNLKSAMSRSTEFTSNSLAIVSKILSALSDLGIPIH 247          
BLAST of CN185700 vs. ExPASy Swiss-Prot
Match: PME26_ARATH (Putative pectinesterase/pectinesterase inhibitor 26 OS=Arabidopsis thaliana GN=PME26 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.401e-18
Identity = 65/177 (36.72%), Postives = 93/177 (52.54%), Query Frame = -3
Query:  195 AESIKTVCSVTQNPDSCFXXXXXXXXXXXXXTKPDPEVILKLSLQVNVNHFSNITSSIKSLY----GNHLEVALRDCVDQLRDASSRLNDSMSELNAT-----LTDRTVNDIQTWISAAMTDEETCLDGLEEM---GSTVADEVKTMMKKSKELLSYSLAIIANIRTLLQKFGLHMH 689
            A S+KTVCSVT  P SCF                DPEVI +LSLQV ++  ++I    K L        L+ AL  C   L  A  R+N+++S +        L   T++D+ TW+SAA+T   TCLD L+E+    S +  ++K+ M  S E  S SLAI+A I + +  FG+ +H
Sbjct:   74 AASLKTVCSVTNYPVSCFSSISKLPLSNTT----DPEVIFRLSLQVVIDELNSIVELPKKLAEETDDEGLKSALSVCEHLLDLAIDRVNETVSAMEVVDGKKILNAATIDDLLTWLSAAVTYHGTCLDALDEISHTNSAIPLKLKSGMVNSTEFTSNSLAIVAKILSTISDFGIPIH 246          

HSP 2 Score: 88.5817 bits (218), Expect = 3.452e-17
Identity = 62/181 (34.25%), Postives = 92/181 (50.83%), Query Frame = -3
Query:  201 AESIKTVCSVTQNPDSCFXXXXXXXXXXXXXTKPDPEVILKLSLQVNVNHFSNITSSIKSLY----GNHLEVALRDCVDQLRDASSRLNDSMSELNAT------LTDRTVNDIQTWISAAMTDEETCLDGLEEM--------GSTVADEVKTMMKKSKELLSYSLAIIANIRTLLQKFGLH 689
            A S++ VCSVT+ P SC                 DPE + +LSLQV +N  ++I    K L        L+ +L  C D   DA   +ND++S +         L   T+++IQTW+SAA+TD +TCLD L+E+         S ++ ++K+ M  S++  S SLAIIA       KF +H
Sbjct:  268 AASLRNVCSVTRYPASCVSSISKLPSSNTT----DPEALFRLSLQVVINELNSIAGLPKKLAEETDDERLKSSLSVCGDVFNDAIDIVNDTISTMEEVGDGKKILKSSTIDEIQTWLSAAVTDHDTCLDALDELSQNKTEYANSPISLKLKSAMVNSRKFTSNSLAIIA-------KFPIH 437          

HSP 3 Score: 75.8702 bits (185), Expect = 2.315e-13
Identity = 54/163 (33.13%), Postives = 80/163 (49.08%), Query Frame = -3
Query:  231 IKTVCSVTQNPDSCFXXXXXXXXXXXXXTKPDPEVILKLSLQVNVNHFSNITSSIKSLY----GNHLEVALRDCVDQLRDASSRLNDSMSELNAT-------LTDRTVNDIQTWISAAMTDEETCLDGLEE--MGSTVADEVKTMMKKSKELLSYSLAIIANI 680
            ++TVC+VT  P SC                 DP+V+ +LSLQV  +  ++I    K L        L+ AL  C D    A   +ND++S L+         L   T+ D+ TW+S+A+TD  TC D L+E    S +  ++K+ M  S E  S SLAI+A +
Sbjct:  459 LRTVCNVTNYPASCISSISKLPLSKTTT---DPKVLFRLSLQVTFDELNSIVGLPKKLAEETNDEGLKSALSVCADVFDLAVDSVNDTISSLDEVISGGKKNLNSSTIGDLITWLSSAVTDIGTCGDTLDEDNYNSPIPQKLKSAMVNSTEFTSNSLAIVAQV 618          
The following BLAST results are available for this feature:
BLAST of CN185700 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
PME3_PHAVU1.354e-2136.00Pectinesterase 3 OS=Phaseolus vulgaris GN=MPE3 PE=... [more]
PME1_ARATH1.769e-2134.44Pectinesterase 1 OS=Arabidopsis thaliana GN=PME1 P... [more]
PME26_ARATH1.401e-1836.72Putative pectinesterase/pectinesterase inhibitor 2... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001L22_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001L22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185700 ID=CN185700|Name=CN185700|organism=Citrus sinensis|type=EST|length=694bp
ATTTATTTATTTGAATAACCTTGGGTCGGCATATGTTTCTTGACAATAAG
CTCGGCCCAAAGAGAATAAAAACAAAGAGGTGAAACGAATTTATCAGAAT
ACACAAGTGATTGACATGGTCTTGATTGATGCCCACCGACAAACGAATAT
TTCTGAAATTCGGAGATTTTTTTTTGAGTGTTCAATTTCAATCAATGCAT
ATGGAGGCCAAATTTCTGAAGAAGTGTTCGGATGTTAGCAATAATAGCCA
GGCTGTAACTGAGTAACTCCTTTGACTTTTTCATCATGGTCTTGACTTCA
TCAGCCACCGTTGATCCCATCTCCTCCAATCCGTCCAAGCAAGTTTCTTC
GTCCGTCATGGCCGCGCTGATCCACGTCTGGATGTCGTTGACAGTCCTGT
CAGTCAACGTGGCGTTCAACTCAGACATGGAGTCGTTGAGTCGACTCGAC
GCGTCCCGCAGCTGATCCACGCAGTCGCGTAAAGCAACCTCAAGGTGATT
ACCGTAAAGACTTTTAATCGAAGAAGTGATGTTTGAGAAGTGATTGACGT
TGACTTGCAGAGAGAGCTTCAAGATCACTTCTGGGTCTGGTTTTGTCGTT
GTCGATGAGATGTTGAGAGAAGAAGATAAGGCGGTGAAGCATGAATCCGG
GTTCTGGGTAACGCTGCACACCGTTTTGATCGACTCGGCAGCGT
back to top