DC899992

Overview
NameDC899992
Unique NameDC899992
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length480
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC899992_ssr348 microsatellite DC899992_ssr348:348..359. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4248 contig Csv1_Contig4248:313..792. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899992 vs. ExPASy Swiss-Prot
Match: MFT_ARATH (Protein MOTHER of FT and TF 1 OS=Arabidopsis thaliana GN=MFT PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.990e-29
Identity = 59/76 (77.63%), Postives = 70/76 (92.11%), Query Frame = 3
Query:   18 TRGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGL-VEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 242
            +RG EILPYM PRPPVGIHRYI+VLF+Q +P+GL V+QPP+RANF+TR+FAG+ DLGLPVAT+YFN QKEPASRRR
Sbjct:   98 SRGKEILPYMEPRPPVGIHRYILVLFRQNSPVGLMVQQPPSRANFSTRMFAGHFDLGLPVATVYFNAQKEPASRRR 173          
BLAST of DC899992 vs. ExPASy Swiss-Prot
Match: CEN_ARATH (Protein CENTRORADIALIS-like OS=Arabidopsis thaliana GN=CEN PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.923e-15
Identity = 39/73 (53.42%), Postives = 50/73 (68.49%), Query Frame = 3
Query:   24 GMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 242
            G EI+ Y  PRP +GIHR++ +LF+Q     +V  P  R  FNTR FA   DLGLPVA ++FNCQ+E A+RRR
Sbjct:  103 GKEIIGYEMPRPNIGIHRFVYLLFKQTRRGSVVSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQRETAARRR 175          
BLAST of DC899992 vs. ExPASy Swiss-Prot
Match: TFL1_ARATH (Protein TERMINAL FLOWER 1 OS=Arabidopsis thaliana GN=TFL1 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.511e-15
Identity = 38/75 (50.67%), Postives = 52/75 (69.33%), Query Frame = 3
Query:   18 TRGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 242
            T G E++ Y  PRP +GIHR++ VLF+QK    +    P+R +FNTR FA   DLGLPVA ++FN Q+E A+R+R
Sbjct:  103 TFGKEVVSYELPRPSIGIHRFVFVLFRQKQRRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAARKR 177          
BLAST of DC899992 vs. ExPASy Swiss-Prot
Match: CET2_TOBAC (CEN-like protein 2 OS=Nicotiana tabacum GN=CET2 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 7.306e-15
Identity = 37/73 (50.68%), Postives = 51/73 (69.86%), Query Frame = 3
Query:   24 GMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 242
            G EI+ Y  PRP +GIHR++ +LF+QK    ++  P +R  FNTR FA   +LG PVA ++FNCQ+E A+RRR
Sbjct:  103 GKEIVGYEMPRPNIGIHRFVFLLFKQKKRQTVLTAPLSRDRFNTRKFAEENELGSPVAAVFFNCQRETAARRR 175          
BLAST of DC899992 vs. ExPASy Swiss-Prot
Match: CET4_TOBAC (CEN-like protein 4 OS=Nicotiana tabacum GN=CET4 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.628e-14
Identity = 37/73 (50.68%), Postives = 50/73 (68.49%), Query Frame = 3
Query:   24 GMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 242
            G EI+ Y  PRP +GIHR++ +LF+QK    L+  P +R  FNTR F+   +LG PVA  +FNCQ+E A+RRR
Sbjct:  103 GREIVGYEMPRPNIGIHRFVFLLFKQKKRQTLLSAPLSRDRFNTRKFSEENELGSPVAAAFFNCQRETAARRR 175          
BLAST of DC899992 vs. ExPASy Swiss-Prot
Match: CEN_ANTMA (Protein CENTRORADIALIS OS=Antirrhinum majus GN=CEN PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.735e-14
Identity = 37/75 (49.33%), Postives = 50/75 (66.67%), Query Frame = 3
Query:   24 GMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPT--RANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 242
            G E++ Y  PRP +GIHR++ +LF+QK     +  PP   R  FNTR F    +LGLPVA ++FNCQ+E A+RRR
Sbjct:  107 GKEVVSYEMPRPNIGIHRFVFLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQRETAARRR 181          
BLAST of DC899992 vs. ExPASy Swiss-Prot
Match: SELFP_SOLLC (Protein SELF-PRUNING OS=Solanum lycopersicum GN=SP PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.350e-13
Identity = 33/73 (45.21%), Postives = 50/73 (68.49%), Query Frame = 3
Query:   24 GMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 242
            G E++ Y  PRP +GIHR++ +LF+QK    +   P +R  F++R F+   +LG PVA ++FNCQ+E A+RRR
Sbjct:  103 GREVVGYEMPRPNIGIHRFVFLLFKQKKRQTISSAPVSRDQFSSRKFSEENELGSPVAAVFFNCQRETAARRR 175          
BLAST of DC899992 vs. ExPASy Swiss-Prot
Match: CET1_TOBAC (CEN-like protein 1 OS=Nicotiana tabacum GN=CET1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.989e-12
Identity = 34/73 (46.58%), Postives = 48/73 (65.75%), Query Frame = 3
Query:   24 GMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 242
            G EI+ Y  P+P +GIHRY+++L++Q      V+   TR +FNTR +     LG PVA +YFN Q+E A+RRR
Sbjct:  103 GREIVSYESPKPVIGIHRYVLLLYKQSGRQ-TVKPAATRDHFNTRRYTAENGLGSPVAAVYFNAQRETAARRR 174          
BLAST of DC899992 vs. ExPASy Swiss-Prot
Match: BFT_ARATH (Protein BROTHER of FT and TFL 1 OS=Arabidopsis thaliana GN=BFT PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.989e-12
Identity = 34/73 (46.58%), Postives = 43/73 (58.90%), Query Frame = 3
Query:   24 GMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 242
            G EI+ Y  P+P  GIHRY+  LF+Q+    +   P TR  FNT  F+    L  PVA +YFN Q+E A RRR
Sbjct:  102 GREIVRYETPKPVAGIHRYVFALFKQRGRQAVKAAPETRECFNTNAFSSYFGLSQPVAAVYFNAQRETAPRRR 174          
BLAST of DC899992 vs. ExPASy Swiss-Prot
Match: TSF_ARATH (Protein TWIN SISTER of FT OS=Arabidopsis thaliana GN=TSF PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.290e-11
Identity = 38/69 (55.07%), Postives = 45/69 (65.22%), Query Frame = 3
Query:   24 GMEILPYMGPRPPVGIHRYIMVLFQQKAPLG--LVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKE 224
            G E++ Y  PRPP GIHR ++VLF+Q   LG   V  P  R  FNTR FA   +LGLPVA  YFNCQ+E
Sbjct:  102 GNEVVCYESPRPPSGIHRIVLVLFRQ---LGRQTVYAPGWRQQFNTREFAEIYNLGLPVAASYFNCQRE 167          
The following BLAST results are available for this feature:
BLAST of DC899992 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
MFT_ARATH3.990e-2977.63Protein MOTHER of FT and TF 1 OS=Arabidopsis thali... [more]
CEN_ARATH1.923e-1553.42Protein CENTRORADIALIS-like OS=Arabidopsis thalian... [more]
TFL1_ARATH2.511e-1550.67Protein TERMINAL FLOWER 1 OS=Arabidopsis thaliana ... [more]
CET2_TOBAC7.306e-1550.68CEN-like protein 2 OS=Nicotiana tabacum GN=CET2 PE... [more]
CET4_TOBAC1.628e-1450.68CEN-like protein 4 OS=Nicotiana tabacum GN=CET4 PE... [more]
CEN_ANTMA4.735e-1449.33Protein CENTRORADIALIS OS=Antirrhinum majus GN=CEN... [more]
SELFP_SOLLC2.350e-1345.21Protein SELF-PRUNING OS=Solanum lycopersicum GN=SP... [more]
CET1_TOBAC1.989e-1246.58CEN-like protein 1 OS=Nicotiana tabacum GN=CET1 PE... [more]
BFT_ARATH1.989e-1246.58Protein BROTHER of FT and TFL 1 OS=Arabidopsis tha... [more]
TSF_ARATH1.290e-1155.07Protein TWIN SISTER of FT OS=Arabidopsis thaliana ... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC899992 VSS Citrus sinensis cDNA clone VS27Q03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899992 ID=DC899992|Name=DC899992|organism=Citrus sinensis|type=EST|length=480bp
CTCGTGCCGAATTCGGCACGAGAGGGATGGAGATTCTGCCGTACATGGGG
CCACGGCCACCGGTGGGGATTCATCGATACATAATGGTGCTGTTTCAGCA
GAAGGCTCCATTGGGGCTGGTCGAGCAGCCACCAACGAGGGCTAACTTCA
ACACTCGGCTCTTTGCTGGGAATCTGGATCTTGGCCTCCCTGTGGCCACT
ATTTACTTCAACTGTCAGAAGGAACCGGCAAGCCGCAGGCGTTGAACAAT
CAAGGAGGCGCTAGCTAGTGCTCAGCTCAAGTGTAATAGACAAAGAGAGT
TGTGGTGTCTTTAATATGTTTCTCTTTTGGTTTTGGTTTTCCTTTTCCTT
TCTTTCTTTTTTTTTCCCCGCAAGTGTACTGTCTCGTTTTAGTCTTAGCA
TGTAGGTGTTGGCTTTGTTTAATCAGGCTAAAGTTCATGTAATGTAAGCT
GTTTCCCTTGTAATAAGGCTTTCGTTTCAA
back to top