CN185695

Overview
NameCN185695
Unique NameCN185695
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length775
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10680 contig Csv1_Contig10680:495..1267. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185695 vs. ExPASy Swiss-Prot
Match: FABD_BACSU (Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fabD PE=3 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 6.664e-23
Identity = 58/162 (35.80%), Postives = 92/162 (56.79%), Query Frame = -1
Query:  275 SGIIGLDSDKVQQLCDAANQEVDEDNKVQIANYLCPGNYAVSGGVKGIEAVEAKAKSFKARMTVRLAVAGAFHTGFMEPAVTRLEAALAATQINTPRMPVISNVDAQPHADPEVIKKILAQQVTSPVQWEXXXXXXXXXXXXKSYELGPGKVIAGIVKRLDK 760
            + I+G+D++ ++Q+ D   +E    N VQ+AN  CPG   +SG  KG+E     AK   A+  + L V+G FH+  M+PA  +L+  L A  I    +PVISNV A    +   IK+ L +Q+ SPV++E               E+GPGKV++G+VK++++
Sbjct:  132 AAILGMDAEALKQVTDKVTEE---GNLVQLANLNCPGQIVISGTAKGVELASELAKENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDACDIKDADVPVISNVSADVMTEKADIKEKLIEQLYSPVRFEESINKLIAEGVTTFIEIGPGKVLSGLVKKVNR 290          
BLAST of CN185695 vs. ExPASy Swiss-Prot
Match: FABD_STAAW (Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.815e-20
Identity = 53/169 (31.36%), Postives = 92/169 (54.44%), Query Frame = -1
Query:  254 SGIIGLDSDKVQQLCDAANQEVDEDNKVQIANYLCPGNYAVSGGVKGIEAVEAKAKSFKARMTVRLAVAGAFHTGFMEPAVTRLEAALAATQINTPRMPVISNVDAQPHADPEVIKKILAQQVTSPVQWEXXXXXXXXXXXXKSYELGPGKVIAGIVKRLDKSAEMENI 760
            + ++GLD DKV ++C + + +   D  ++ AN  CPG   VSG    I+ +  K KS  A+  + LAV+G FH+  M+       + +   +    + PV+ NV+AQ   D EVIK  + +Q+ SPVQ+                E+GPGKV++G++K++++  ++ +I
Sbjct:  130 AAVLGLDFDKVDEICKSLSSD---DKIIEPANINCPGQIVVSGHKALIDELVEKGKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEVIKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSI 295          
BLAST of CN185695 vs. ExPASy Swiss-Prot
Match: FABD_STAAU (Malonyl-CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.815e-20
Identity = 53/169 (31.36%), Postives = 92/169 (54.44%), Query Frame = -1
Query:  254 SGIIGLDSDKVQQLCDAANQEVDEDNKVQIANYLCPGNYAVSGGVKGIEAVEAKAKSFKARMTVRLAVAGAFHTGFMEPAVTRLEAALAATQINTPRMPVISNVDAQPHADPEVIKKILAQQVTSPVQWEXXXXXXXXXXXXKSYELGPGKVIAGIVKRLDKSAEMENI 760
            + ++GLD DKV ++C + + +   D  ++ AN  CPG   VSG    I+ +  K KS  A+  + LAV+G FH+  M+       + +   +    + PV+ NV+AQ   D EVIK  + +Q+ SPVQ+                E+GPGKV++G++K++++  ++ +I
Sbjct:  130 AAVLGLDFDKVDEICKSLSSD---DKIIEPANINCPGQIVVSGHKALIDELVEKGKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEVIKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSI 295          
BLAST of CN185695 vs. ExPASy Swiss-Prot
Match: FABD_STAAR (Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.815e-20
Identity = 53/169 (31.36%), Postives = 92/169 (54.44%), Query Frame = -1
Query:  254 SGIIGLDSDKVQQLCDAANQEVDEDNKVQIANYLCPGNYAVSGGVKGIEAVEAKAKSFKARMTVRLAVAGAFHTGFMEPAVTRLEAALAATQINTPRMPVISNVDAQPHADPEVIKKILAQQVTSPVQWEXXXXXXXXXXXXKSYELGPGKVIAGIVKRLDKSAEMENI 760
            + ++GLD DKV ++C + + +   D  ++ AN  CPG   VSG    I+ +  K KS  A+  + LAV+G FH+  M+       + +   +    + PV+ NV+AQ   D EVIK  + +Q+ SPVQ+                E+GPGKV++G++K++++  ++ +I
Sbjct:  130 AAVLGLDFDKVDEICKSLSSD---DKIIEPANINCPGQIVVSGHKALIDELVEKGKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEVIKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSI 295          
BLAST of CN185695 vs. ExPASy Swiss-Prot
Match: FABD_STAAN (Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.815e-20
Identity = 53/169 (31.36%), Postives = 92/169 (54.44%), Query Frame = -1
Query:  254 SGIIGLDSDKVQQLCDAANQEVDEDNKVQIANYLCPGNYAVSGGVKGIEAVEAKAKSFKARMTVRLAVAGAFHTGFMEPAVTRLEAALAATQINTPRMPVISNVDAQPHADPEVIKKILAQQVTSPVQWEXXXXXXXXXXXXKSYELGPGKVIAGIVKRLDKSAEMENI 760
            + ++GLD DKV ++C + + +   D  ++ AN  CPG   VSG    I+ +  K KS  A+  + LAV+G FH+  M+       + +   +    + PV+ NV+AQ   D EVIK  + +Q+ SPVQ+                E+GPGKV++G++K++++  ++ +I
Sbjct:  130 AAVLGLDFDKVDEICKSLSSD---DKIIEPANINCPGQIVVSGHKALIDELVEKGKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEVIKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSI 295          
BLAST of CN185695 vs. ExPASy Swiss-Prot
Match: FABD_STAAM (Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.815e-20
Identity = 53/169 (31.36%), Postives = 92/169 (54.44%), Query Frame = -1
Query:  254 SGIIGLDSDKVQQLCDAANQEVDEDNKVQIANYLCPGNYAVSGGVKGIEAVEAKAKSFKARMTVRLAVAGAFHTGFMEPAVTRLEAALAATQINTPRMPVISNVDAQPHADPEVIKKILAQQVTSPVQWEXXXXXXXXXXXXKSYELGPGKVIAGIVKRLDKSAEMENI 760
            + ++GLD DKV ++C + + +   D  ++ AN  CPG   VSG    I+ +  K KS  A+  + LAV+G FH+  M+       + +   +    + PV+ NV+AQ   D EVIK  + +Q+ SPVQ+                E+GPGKV++G++K++++  ++ +I
Sbjct:  130 AAVLGLDFDKVDEICKSLSSD---DKIIEPANINCPGQIVVSGHKALIDELVEKGKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEVIKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSI 295          
BLAST of CN185695 vs. ExPASy Swiss-Prot
Match: FABD_STAAC (Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.815e-20
Identity = 53/169 (31.36%), Postives = 92/169 (54.44%), Query Frame = -1
Query:  254 SGIIGLDSDKVQQLCDAANQEVDEDNKVQIANYLCPGNYAVSGGVKGIEAVEAKAKSFKARMTVRLAVAGAFHTGFMEPAVTRLEAALAATQINTPRMPVISNVDAQPHADPEVIKKILAQQVTSPVQWEXXXXXXXXXXXXKSYELGPGKVIAGIVKRLDKSAEMENI 760
            + ++GLD DKV ++C + + +   D  ++ AN  CPG   VSG    I+ +  K KS  A+  + LAV+G FH+  M+       + +   +    + PV+ NV+AQ   D EVIK  + +Q+ SPVQ+                E+GPGKV++G++K++++  ++ +I
Sbjct:  130 AAVLGLDFDKVDEICKSLSSD---DKIIEPANINCPGQIVVSGHKALIDELVEKGKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEVIKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSI 295          
BLAST of CN185695 vs. ExPASy Swiss-Prot
Match: FABD_STAAS (Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.370e-20
Identity = 53/169 (31.36%), Postives = 92/169 (54.44%), Query Frame = -1
Query:  254 SGIIGLDSDKVQQLCDAANQEVDEDNKVQIANYLCPGNYAVSGGVKGIEAVEAKAKSFKARMTVRLAVAGAFHTGFMEPAVTRLEAALAATQINTPRMPVISNVDAQPHADPEVIKKILAQQVTSPVQWEXXXXXXXXXXXXKSYELGPGKVIAGIVKRLDKSAEMENI 760
            + ++GLD DKV ++C + + +   D  ++ AN  CPG   VSG    I+ +  K KS  A+  + LAV+G FH+  M+       + +   +    + PV+ NV+AQ   D EVIK  + +Q+ SPVQ+                E+GPGKV++G++K++++  ++ +I
Sbjct:  130 AAVLGLDFDKVDEICKSLSSD---DKIIEPANINCPGQIVVSGHKALIDELVEKGKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDNEVIKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSI 295          
BLAST of CN185695 vs. ExPASy Swiss-Prot
Match: FABD_ECOLI (Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 1.699e-18
Identity = 50/160 (31.25%), Postives = 79/160 (49.38%), Query Frame = -1
Query:  281 SGIIGLDSDKVQQLCDAANQEVDEDNKVQIANYLCPGNYAVSGGVKGIEAVEAKAKSFKARMTVRLAVAGAFHTGFMEPAVTRLEAALAATQINTPRMPVISNVDAQPHADPEVIKKILAQQVTSPVQWEXXXXXXXXXXXXKSYELGPGKVIAGIVKRL 760
            + IIGLD   + + C+    E  E   V   N+  PG   ++G  + +E   A  K+  A+  + L V+   H   M+PA  +L   LA    N P +PV++NVD +   + + I+  L +Q+ +PVQW               YE+GPGKV+ G+ KR+
Sbjct:  133 AAIIGLDDASIAKACE----EAAEGQVVSPVNFNSPGQVVIAGHKEAVERAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCETNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRI 288          
BLAST of CN185695 vs. ExPASy Swiss-Prot
Match: FABD_ECOL6 (Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6 GN=fabD PE=3 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 1.699e-18
Identity = 50/160 (31.25%), Postives = 79/160 (49.38%), Query Frame = -1
Query:  281 SGIIGLDSDKVQQLCDAANQEVDEDNKVQIANYLCPGNYAVSGGVKGIEAVEAKAKSFKARMTVRLAVAGAFHTGFMEPAVTRLEAALAATQINTPRMPVISNVDAQPHADPEVIKKILAQQVTSPVQWEXXXXXXXXXXXXKSYELGPGKVIAGIVKRL 760
            + IIGLD   + + C+    E  E   V   N+  PG   ++G  + +E   A  K+  A+  + L V+   H   M+PA  +L   LA    N P +PV++NVD +   + + I+  L +Q+ +PVQW               YE+GPGKV+ G+ KR+
Sbjct:  133 AAIIGLDDASIAKACE----EAAEGQVVSPVNFNSPGQVVIAGHKEAVERAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCETNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRI 288          
The following BLAST results are available for this feature:
BLAST of CN185695 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
FABD_BACSU6.664e-2335.80Malonyl CoA-acyl carrier protein transacylase OS=B... [more]
FABD_STAAW1.815e-2031.36Malonyl CoA-acyl carrier protein transacylase OS=S... [more]
FABD_STAAU1.815e-2031.36Malonyl-CoA-acyl carrier protein transacylase OS=S... [more]
FABD_STAAR1.815e-2031.36Malonyl CoA-acyl carrier protein transacylase OS=S... [more]
FABD_STAAN1.815e-2031.36Malonyl CoA-acyl carrier protein transacylase OS=S... [more]
FABD_STAAM1.815e-2031.36Malonyl CoA-acyl carrier protein transacylase OS=S... [more]
FABD_STAAC1.815e-2031.36Malonyl CoA-acyl carrier protein transacylase OS=S... [more]
FABD_STAAS2.370e-2031.36Malonyl CoA-acyl carrier protein transacylase OS=S... [more]
FABD_ECOLI1.699e-1831.25Malonyl CoA-acyl carrier protein transacylase OS=E... [more]
FABD_ECOL61.699e-1831.25Malonyl CoA-acyl carrier protein transacylase OS=E... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001L20_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001L20, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185695 ID=CN185695|Name=CN185695|organism=Citrus sinensis|type=EST|length=775bp
TTTAATTAAAACTTATCTAATATATTATTGCACCAAATACAAGTAGTGTT
ACATATATAATGCGTAAAGAAAGACTGTTTTTACAATCTAATCCTGATTC
AAAGAATTTTAAGTTAATAAGGAGGCTATTCAAAATGGTCTCTAATACAC
AAAAAGTTCATGGTTTCAATGTAATTCTTTTAGCTTGGCTTGAACAAAGA
AACTCTGCCAGGAAATGGTGAAGCCGCCGTGTTTAGTTAAACTTCTAAGC
CCCGATATTCTCCATCTCAGCACTCTTGTCCAACCTCTTGACAATGCCAG
CAATAACCTTTCCTGGTCCCAATTCGTAACTCTTCTTCAGCCCTTTGCCA
AGGAGAGTCTTCACTGTTGTTTCCCATTGGACGGGAGATGTCACCTGTTG
GGCCAATATCTTCTTAATCACTTCTGGATCTGCATGAGGCTGTGCATCAA
CATTAGATATAACTGGCATTCTTGGTGTGTTGATCTGGGTTGCTGCTAAT
GCAGCTTCCAATCTTGTGACAGCTGGCTCCATGAAACCGGTATGGAAAGC
GCCAGCAACAGCAAGACGCACTGTCATTCGAGCCTTGAATGACTTAGCTT
TGGCTTCAACTGCTTCTATTCCTTTAACACCCCCAGATACTGCATAATTA
CCAGGACAGAGATAGTTTGCAATTTGAACTTTATTATCTTCATCAACTTC
TTGATTGGCTGCATCACACAGCTGCTGAACCTTGTCTGAATCCAATCCAA
TAATGCCTGACCATGGCACCTTTTA
back to top