CN185693

Overview
NameCN185693
Unique NameCN185693
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length701
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN185693_ssr26 microsatellite CN185693_ssr26:26..37. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2499 contig Csv1_Contig2499:1..701. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185693 vs. ExPASy Swiss-Prot
Match: FABD_MOUSE (Malonyl CoA-acyl carrier protein transacylase, mitochondrial OS=Mus musculus GN=Mcat PE=2 SV=3)

HSP 1 Score: 132.88 bits (333), Expect = 1.637e-30
Identity = 67/138 (48.55%), Postives = 90/138 (65.22%), Query Frame = 2
Query:  281 NAFLFPGQGAQAVGMGKEAQSVPAAAELYKKANDILGFDLLEICTNGPKEKLDSTIISQPAIYVTSLAAVELLRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDGLKLVKLRGKAMQEAADAAKGAMVSIIG 694
            +  LFPGQG QAVGMG     +P   +LY+ A+ +LG+DLLE+C  GP+E LD T+  QPA++V SLAAVE L        +ID+     G S+GE+ AL FAGA  F +GL  VK R +AMQEA++A    M+S++G
Sbjct:   61 SVLLFPGQGCQAVGMGSGLLHLPRVRQLYEAAHRVLGYDLLELCLRGPQEDLDRTVHCQPAVFVASLAAVEKLHHLQ--PAVIDNCVAAAGFSVGEFAALVFAGAMDFSEGLYAVKARAEAMQEASEAVPSGMLSVLG 196          
BLAST of CN185693 vs. ExPASy Swiss-Prot
Match: FABD_HUMAN (Malonyl CoA-acyl carrier protein transacylase, mitochondrial OS=Homo sapiens GN=MCAT PE=1 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 2.364e-29
Identity = 66/138 (47.83%), Postives = 90/138 (65.22%), Query Frame = 2
Query:  281 NAFLFPGQGAQAVGMGKEAQSVPAAAELYKKANDILGFDLLEICTNGPKEKLDSTIISQPAIYVTSLAAVELLRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDGLKLVKLRGKAMQEAADAAKGAMVSIIG 694
            +  LFPGQG+Q VGMG+   + P   ELY  A  +LG+DLLE+  +GP+E LD T+  QPAI+V SLAAVE L        +I++     G S+GE+ AL FAGA  F +GL  VK+R +AMQEA++A    M+S++G
Sbjct:   63 SVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQ--PSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLG 198          
BLAST of CN185693 vs. ExPASy Swiss-Prot
Match: FABD_DROME (Probable malonyl CoA-acyl carrier protein transacylase, mitochondrial OS=Drosophila melanogaster GN=beg PE=2 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.434e-26
Identity = 65/138 (47.10%), Postives = 89/138 (64.49%), Query Frame = 2
Query:  266 DYKPTNAFLFPGQGAQAVGMGKEAQSVPAAAELYKKANDILGFDLLEICTNGPKEKLDSTIISQPAIYVTSLAAVELLRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDGLKLVKLRGKAMQEAADAAKGAM 679
            D K T+  LFPGQG Q VGM K+    P A  +++ AN++L +DLL+IC  GP+EKL+ T  +Q A+ V+SLAA+E L  R+   + I++     G SLGE TAL +A A  F+  L+LV++R  AMQ A D A GAM
Sbjct:   63 DPKETSVMLFPGQGTQYVGMAKDLLRFPGARRIFELANEVLKYDLLKICLEGPREKLNRTEHAQLAVMVSSLAALEQL--REERPKAIETCVAAAGFSLGEITALVYADALPFDKALRLVQVRATAMQAACDQAAGAM 198          
BLAST of CN185693 vs. ExPASy Swiss-Prot
Match: FABD_BACSU (Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fabD PE=3 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 3.306e-23
Identity = 63/140 (45.00%), Postives = 89/140 (63.57%), Query Frame = 2
Query:  284 AFLFPGQGAQAVGMGKEA-QSVPAAAELYKKANDILGFDLLEICTNGPKEKLDSTIISQPAIYVTSLAAVELLRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDGLKLVKLRGKAMQEAADAAKGAMVSIIGLD 700
            AFLFPGQG+Q +GMGKE  + VPAA  L+ +A++ L   L  +   G  E+L  T  +QPA+  TS+A +E  + ++ G     + D T G SLGEY+AL  AGA SF+D +  V+ RG+ M EA  A +GAM +I+G+D
Sbjct:    5 AFLFPGQGSQFIGMGKELYEQVPAAKRLFDEADETLETKLSSLIFEGDAEELTLTYNAQPALLTTSIAVLE--KFKESGI----TPDFTAGHSLGEYSALVAAGALSFKDAVYTVRKRGEFMNEAVPAGEGAMAAILGMD 138          
BLAST of CN185693 vs. ExPASy Swiss-Prot
Match: FABD_HAEIN (Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae GN=fabD PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 9.619e-23
Identity = 61/140 (43.57%), Postives = 85/140 (60.71%), Query Frame = 2
Query:  284 AFLFPGQGAQAVGMGKE-AQSVPAAAELYKKANDILGFDLLEICTNGPKEKLDSTIISQPAIYVTSLAAVELLRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDGLKLVKLRGKAMQEAADAAKGAMVSIIGLD 700
            A +FPGQG+Q VGM  + A   P   E +K+A+D LG+DL  +   GP E+L+ T  +QPA+   S+A   + + +    +     +V  G SLGEY+AL  AG   F+D +KLV+LRGK MQ+A     GAM +IIGLD
Sbjct:    5 AMVFPGQGSQTVGMLADLATEYPIVIETFKQASDALGYDLWYLVQQGPAEELNKTWQTQPALLAASVAIYRVWKEKFPQLK----PEVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGKLMQQAVPEGTGAMYAIIGLD 140          
BLAST of CN185693 vs. ExPASy Swiss-Prot
Match: FABD_ECOLI (Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 4.774e-22
Identity = 60/140 (42.86%), Postives = 84/140 (60.00%), Query Frame = 2
Query:  284 AFLFPGQGAQAVGMGKE-AQSVPAAAELYKKANDILGFDLLEICTNGPKEKLDSTIISQPAIYVTSLAAVELLRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDGLKLVKLRGKAMQEAADAAKGAMVSIIGLD 700
            AF+FPGQG+Q VGM  + A S P   E + +A+  LG+DL  +   GP E+L+ T  +QPA+   S+A   + + + G      +  +  G SLGEY+AL  AG   F D ++LV++RGK MQEA     GAM +IIGLD
Sbjct:    5 AFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPALLTASVALYRVWQQQGG-----KAPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKFMQEAVPEGTGAMAAIIGLD 139          
BLAST of CN185693 vs. ExPASy Swiss-Prot
Match: FABD_ECOL6 (Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6 GN=fabD PE=3 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 4.774e-22
Identity = 60/140 (42.86%), Postives = 84/140 (60.00%), Query Frame = 2
Query:  284 AFLFPGQGAQAVGMGKE-AQSVPAAAELYKKANDILGFDLLEICTNGPKEKLDSTIISQPAIYVTSLAAVELLRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDGLKLVKLRGKAMQEAADAAKGAMVSIIGLD 700
            AF+FPGQG+Q VGM  + A S P   E + +A+  LG+DL  +   GP E+L+ T  +QPA+   S+A   + + + G      +  +  G SLGEY+AL  AG   F D ++LV++RGK MQEA     GAM +IIGLD
Sbjct:    5 AFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPALLTASVALYRVWQQQGG-----KAPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKFMQEAVPEGTGAMAAIIGLD 139          
BLAST of CN185693 vs. ExPASy Swiss-Prot
Match: FABD_ECO57 (Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3)

HSP 1 Score: 104.375 bits (259), Expect = 6.235e-22
Identity = 60/140 (42.86%), Postives = 83/140 (59.29%), Query Frame = 2
Query:  284 AFLFPGQGAQAVGMGKE-AQSVPAAAELYKKANDILGFDLLEICTNGPKEKLDSTIISQPAIYVTSLAAVELLRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDGLKLVKLRGKAMQEAADAAKGAMVSIIGLD 700
            AF+FPGQG+Q VGM  + A S P   E + +A+  LG+DL  +   GP E+L+ T  +QPA+   S+A   + +   G      +  +  G SLGEY+AL  AG   F D ++LV++RGK MQEA     GAM +IIGLD
Sbjct:    5 AFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPALLTASVALYRVWQQHGG-----KAPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKFMQEAVPEGTGAMAAIIGLD 139          
BLAST of CN185693 vs. ExPASy Swiss-Prot
Match: FABD_SALTY (Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium GN=fabD PE=1 SV=3)

HSP 1 Score: 102.834 bits (255), Expect = 1.814e-21
Identity = 59/140 (42.14%), Postives = 84/140 (60.00%), Query Frame = 2
Query:  284 AFLFPGQGAQAVGMGKE-AQSVPAAAELYKKANDILGFDLLEICTNGPKEKLDSTIISQPAIYVTSLAAVELLRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDGLKLVKLRGKAMQEAADAAKGAMVSIIGLD 700
            AF+FPGQG+Q+VGM  E A + P   E + +A+  LG+DL  +   GP E+L+ T  +QPA+   S+A   + + + G    +       G SLGEY+AL  AG  +F D ++LV++RGK MQEA     G M +IIGLD
Sbjct:    5 AFVFPGQGSQSVGMLAEMAANYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPALLTASVALWRVWQQQGGKMPAL-----MAGHSLGEYSALVCAGVINFADAVRLVEMRGKFMQEAVPEGTGGMSAIIGLD 139          
BLAST of CN185693 vs. ExPASy Swiss-Prot
Match: BAEE_BACA2 (Polyketide biosynthesis protein baeE OS=Bacillus amyloliquefaciens (strain FZB42) GN=baeE PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.698e-19
Identity = 60/138 (43.48%), Postives = 85/138 (61.59%), Query Frame = 2
Query:  284 AFLFPGQGAQAVGMGKEAQSVPAAAELYKKANDILGFDLLEICTNGPKEKLDSTIISQPAIYVTSLAAVELLRARDGGQQIIDSVDVTCGLSLGEYTALAFAGAFSFEDGLKLVKLRGKAMQEAADAAKGAMVSIIGL 697
            +F+FPGQG+Q +GMG++        EL  KA+ ILG+ + E+C +G  E+L+ T  +QPA+YV + A   L +  + G +     D T G SLGEY AL  +GAF FE+GL+LVK RG+ M  A     G M ++IGL
Sbjct:    3 SFVFPGQGSQRIGMGEDLFG--RYPELTAKADHILGYSIQELCRDG--ERLNQTQFTQPALYVVN-ALSYLKKTEETGLK----PDFTAGHSLGEYNALYASGAFDFEEGLQLVKKRGELMSRAKG---GGMAAVIGL 128          
The following BLAST results are available for this feature:
BLAST of CN185693 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
FABD_MOUSE1.637e-3048.55Malonyl CoA-acyl carrier protein transacylase, mit... [more]
FABD_HUMAN2.364e-2947.83Malonyl CoA-acyl carrier protein transacylase, mit... [more]
FABD_DROME1.434e-2647.10Probable malonyl CoA-acyl carrier protein transacy... [more]
FABD_BACSU3.306e-2345.00Malonyl CoA-acyl carrier protein transacylase OS=B... [more]
FABD_HAEIN9.619e-2343.57Malonyl CoA-acyl carrier protein transacylase OS=H... [more]
FABD_ECOLI4.774e-2242.86Malonyl CoA-acyl carrier protein transacylase OS=E... [more]
FABD_ECOL64.774e-2242.86Malonyl CoA-acyl carrier protein transacylase OS=E... [more]
FABD_ECO576.235e-2242.86Malonyl CoA-acyl carrier protein transacylase OS=E... [more]
FABD_SALTY1.814e-2142.14Malonyl CoA-acyl carrier protein transacylase OS=S... [more]
BAEE_BACA21.698e-1943.48Polyketide biosynthesis protein baeE OS=Bacillus a... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001L18_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001L18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185693 ID=CN185693|Name=CN185693|organism=Citrus sinensis|type=EST|length=701bp
ATGCCTACGCGTCCCCTCTCCTTCATCTTCTTCTTCTTCCCATTACATTT
TTTACACACATCCTCTAATGGCCACCACCACCTCTCTCGCTTTCTCCTCC
AGTTCACTCCACAACCGCTACCACAAGCGCACCACCTTTTTTAATGGGTC
TGCTGCTTCTTTCAACAGAATTGGAGTTCGAAGAAGCCTTGCCCGATCTG
GGGTTTTTATGAGCGTGTCTGTTGGCAAACACACTGCTGTAACTGTTGAT
GATGCCCTGTTTGCGGATTACAAGCCCACCAATGCTTTCTTGTTTCCTGG
TCAGGGTGCACAAGCAGTTGGAATGGGGAAGGAGGCTCAGAGCGTACCAG
CTGCCGCAGAGCTATACAAGAAAGCAAATGATATATTAGGTTTTGATTTG
CTAGAAATTTGCACCAATGGACCAAAAGAGAAGCTAGATTCAACTATTAT
CAGCCAGCCTGCCATCTATGTCACAAGTTTAGCGGCAGTTGAACTACTCC
GAGCTCGTGATGGAGGCCAGCAGATAATTGATTCTGTTGATGTCACTTGT
GGTCTGAGTTTAGGTGAATATACTGCTTTAGCCTTTGCTGGAGCTTTCAG
CTTTGAGGATGGACTGAAGCTGGTCAAACTAAGGGGAAAAGCTATGCAGG
AAGCTGCTGATGCTGCTAAAGGTGCCATGGTCAGCATTATTGGATTGGAT
T
back to top