CN185675

Overview
NameCN185675
Unique NameCN185675
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length651
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185675 vs. ExPASy Swiss-Prot
Match: TLP7_ARATH (Tubby-like F-box protein 7 OS=Arabidopsis thaliana GN=TULP7 PE=2 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 2.270e-68
Identity = 134/212 (63.21%), Postives = 150/212 (70.75%), Query Frame = 1
Query:   16 MSLRNSCLSRRISRSFGEAHKSSKETGLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPSFSEKGKFLLAARRYRRGAHSEYIISLDAGDLSQGSNAYVGKLSSDFLGTNFTIYDSRPPHNG 651
            M L  S LSRRIS SF   H+    T                                 +LPELLGEIIRRVE TED WP R++VV CACV K+WREIT D  +S   SGKITFPSCLK PGPR+F +QCLI+RNKKTSTFYLYLALTPSF++KGKFLLAARR+R GA++EYIISLDA D SQGSNAYVGKL SDFLGTNFT+YDS+PPHNG
Sbjct:    1 MPLSRSLLSRRISNSF-RFHQGETTTA------------PESESIPPPSNMAGSSSWSAMLPELLGEIIRRVEETEDRWPQRRDVVTCACVSKKWREITHDFARSSLNSGKITFPSCLKLPGPRDFSNQCLIKRNKKTSTFYLYLALTPSFTDKGKFLLAARRFRTGAYTEYIISLDADDFSQGSNAYVGKLRSDFLGTNFTVYDSQPPHNG 199          
BLAST of CN185675 vs. ExPASy Swiss-Prot
Match: TLP1_ORYSJ (Tubby-like F-box protein 1 OS=Oryza sativa subsp. japonica GN=TULP1 PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.781e-58
Identity = 105/154 (68.18%), Postives = 128/154 (83.12%), Query Frame = 1
Query:  193 LLPELLGEIIRRVETTE-DSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPSFSEKGKFLLAARRYRRGAHSEYIISLDAGDLSQGSNAYVGKLSSDFLGTNFTIYDSRPPHNG 651
            LLPEL+ E++RRVE +  + WP R++VV+CACVC+RWR+    +V+ P  SGKITFPS LKQPGPREFP QC I+RNKK STFYLYL LT +  +KGKFL+AARR+RRG H+EYI+SLDA DLSQGSNAY+GKL SDF GTNF IYDS+PP++G
Sbjct:   37 LLPELMSEVVRRVEASGGERWPARKDVVSCACVCRRWRDAAVAVVRPPAESGKITFPSSLKQPGPREFPMQCFIKRNKKNSTFYLYLGLTNATVDKGKFLMAARRFRRGPHTEYIVSLDADDLSQGSNAYMGKLRSDFWGTNFKIYDSKPPYDG 190          
BLAST of CN185675 vs. ExPASy Swiss-Prot
Match: TLP9_ORYSJ (Tubby-like F-box protein 9 OS=Oryza sativa subsp. japonica GN=TULP9 PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 5.799e-56
Identity = 101/153 (66.01%), Postives = 122/153 (79.74%), Query Frame = 1
Query:  193 LLPELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPSFSEKGKFLLAARRYRRGAHSEYIISLDAGDLSQGSNAYVGKLSSDFLGTNFTIYDSRPPHNG 651
            LLPELL EI+RRV+   + WP R++VVACACVC+RWR+    +V+ P   G+ITFPS LKQPGPR+ P  C IRRNKK STFYLYL+LT + ++KGKFLLAARR+R GAH+EYIIS D  DL  GSN+YVGKL SDFLGT F IYDS+PP++G
Sbjct:   55 LLPELLTEIMRRVDAGAERWPPRRDVVACACVCRRWRDAAVSVVRPPLECGRITFPSSLKQPGPRDAPMHCFIRRNKKNSTFYLYLSLTQALTDKGKFLLAARRFRNGAHTEYIISYDCDDLFPGSNSYVGKLRSDFLGTKFIIYDSQPPYDG 207          
BLAST of CN185675 vs. ExPASy Swiss-Prot
Match: TLP10_ORYSJ (Tubby-like F-box protein 10 OS=Oryza sativa subsp. japonica GN=TULP10 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.595e-53
Identity = 97/153 (63.40%), Postives = 123/153 (80.39%), Query Frame = 1
Query:  193 LLPELLGEIIRRVETTE-DSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPSFSEKGKFLLAARRYRRGAHSEYIISLDAGDLSQGSNAYVGKLSSDFLGTNFTIYDSRPPHN 648
            LLPEL+ E++RRVE +  + WP R+++V+CACVC+RWRE    +V+    SG+ITFPS LKQPGP++FP QC ++RNKK S FYLYL L     +KGKFL+AARR+RRG H+EY+ISLDA DLSQGSNAYVGKL SDF GTNF IYD++PP++
Sbjct:   27 LLPELVEEVVRRVEASGGERWPARKDLVSCACVCRRWREAAAAVVRPLPESGRITFPSSLKQPGPKDFPIQCFVKRNKKKSMFYLYLGLLNGTMDKGKFLMAARRFRRGPHTEYVISLDADDLSQGSNAYVGKLRSDFWGTNFKIYDNQPPYD 179          
BLAST of CN185675 vs. ExPASy Swiss-Prot
Match: TLP6_ORYSJ (Tubby-like F-box protein 6 OS=Oryza sativa subsp. japonica GN=TULP6 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.691e-47
Identity = 87/153 (56.86%), Postives = 118/153 (77.12%), Query Frame = 1
Query:  193 LLPELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPSFSEKGKFLLAARRYRRGAHSEYIISLDAGDLSQGSNAYVGKLSSDFLGTNFTIYDSRPPHNG 651
            L PELL E++ R+E +E  WP R++VVACA VC+ WR ITK+IV+ P  SGK+TFP  LKQPGPR+   +C IRRN+ T T+YLY+ LT + ++ GKFLLAAR+ R+   ++Y+ISLD  D+S+GSN Y+GKL S+FLGT FT+YD+ PP++G
Sbjct:   55 LPPELLREVLVRIEESEVWWPSRRDVVACAGVCRSWRGITKEIVRVPEASGKLTFPISLKQPGPRDGTLKCFIRRNRTTQTYYLYIGLTEALADDGKFLLAARKCRKPTCTDYLISLDMSDMSKGSNTYIGKLRSNFLGTKFTVYDAHPPYDG 207          
BLAST of CN185675 vs. ExPASy Swiss-Prot
Match: TLP12_ORYSJ (Tubby-like F-box protein 12 OS=Oryza sativa subsp. japonica GN=TULP12 PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 3.768e-47
Identity = 88/153 (57.52%), Postives = 119/153 (77.78%), Query Frame = 1
Query:  193 LLPELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPS-FSEKGKFLLAARRYRRGAHSEYIISLDAGDLSQGSNAYVGKLSSDFLGTNFTIYDSRPPHN 648
            L PELL ++++R+E  E +WP R++VVACA VC+ WREI KDIV+SP + GK+TFP  LKQPGPR+   QC I+R+K   T+YLYL L+P+  SE GKFLLAA+R RR   +EYIIS+D+ ++S+ SN YVGK+ S+FLGT F +YD++PP+N
Sbjct:   62 LPPELLRDVMKRLEEGESNWPSRKDVVACAAVCRTWREICKDIVQSPEICGKLTFPVSLKQPGPRDGLIQCFIKRDKSKLTYYLYLCLSPAVLSENGKFLLAAKRNRRATSTEYIISVDSKNISRSSNGYVGKMRSNFLGTKFVVYDTQPPYN 214          
BLAST of CN185675 vs. ExPASy Swiss-Prot
Match: TLP11_ORYSJ (Tubby-like F-box protein 11 OS=Oryza sativa subsp. japonica GN=TULP11 PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.166e-46
Identity = 86/153 (56.21%), Postives = 116/153 (75.82%), Query Frame = 1
Query:  193 LLPELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPSFSEKGKFLLAARRYRRGAHSEYIISLDAGDLSQGSNAYVGKLSSDFLGTNFTIYDSRPPHNG 651
            L PELL E++ RVE +E  WP R++VVACA VC+ WR I ++IV++P  SG +TFP  LKQPGPR+ P +C I RN+ T T+YLY+ LT + ++ GKFLLAAR+ RR   +EY+ISLD  D+S+ +++YVGKL S+FLGT FTIYD+ PP+ G
Sbjct:   58 LPPELLREVLARVEESEGWWPRRRDVVACAGVCRSWRGIVREIVRTPEASGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDALTDDGKFLLAARKCRRTTCTEYLISLDMNDISKRTDSYVGKLRSNFLGTKFTIYDAHPPYAG 210          
BLAST of CN185675 vs. ExPASy Swiss-Prot
Match: TLP2_ORYSJ (Tubby-like F-box protein 2 OS=Oryza sativa subsp. japonica GN=TULP2 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.583e-45
Identity = 86/153 (56.21%), Postives = 111/153 (72.55%), Query Frame = 1
Query:  193 LLPELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPSFSEKGKFLLAARRYRRGAHSEYIISLDAGDLSQGSNAYVGKLSSDFLGTNFTIYDSRPPHNG 651
            L+P+LL +I+R VE   + WP R++VVACA VC+RWR++   +V+ P  SGKITFPS LKQPGPR+ P QC I+RNKK STF+LYL LT   ++  KFLLAARR RRG H EY I++++  L  GS + VG L S+F GT FTI D +PP+ G
Sbjct:   54 LVPDLLADILRCVEAGSERWPPRRDVVACASVCRRWRDVAVAVVQPPLESGKITFPSSLKQPGPRDAPMQCFIKRNKKNSTFFLYLGLTQELTDDEKFLLAARRCRRGLHKEYAITINSDGLFHGSQSCVGNLKSNFTGTKFTIRDWQPPYEG 206          
BLAST of CN185675 vs. ExPASy Swiss-Prot
Match: TLP3_ARATH (Tubby-like F-box protein 3 OS=Arabidopsis thaliana GN=TULP3 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.067e-45
Identity = 86/152 (56.58%), Postives = 115/152 (75.66%), Query Frame = 1
Query:  199 PELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPSFS-EKGKFLLAARRYRRGAHSEYIISLDAGDLSQGSNAYVGKLSSDFLGTNFTIYDSRPPHNG 651
            PELL +++ R+E +ED+WP R+NVV+CA VC+ WREI K+IV+ P LS K+TFP  LKQPGPR    QC I RN+   T+YLYL L  + S + GKFLLAA+R+RR   ++YIISL+  D+S+GSN Y+GKL S+FLGT FT+YD++P + G
Sbjct:   57 PELLRDVLMRIEQSEDTWPSRKNVVSCAGVCRNWREIVKEIVRVPELSSKLTFPISLKQPGPRGSLVQCYIMRNRSNQTYYLYLGLNQAASNDDGKFLLAAKRFRRPTCTDYIISLNCDDVSRGSNTYIGKLRSNFLGTKFTVYDAQPTNPG 208          
BLAST of CN185675 vs. ExPASy Swiss-Prot
Match: TLP8_ORYSJ (Tubby-like F-box protein 8 OS=Oryza sativa subsp. japonica GN=TULP8 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.026e-44
Identity = 84/154 (54.55%), Postives = 118/154 (76.62%), Query Frame = 1
Query:  193 LLPELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPGPREFPHQCLIRRNKKTSTFYLYLAL-TPSFSEKGKFLLAARRYRRGAHSEYIISLDAGDLSQGSNAYVGKLSSDFLGTNFTIYDSRPPHNG 651
            L PELL ++IRR+E +E +WP R++VV+CA VCK WRE+ K+IV SP   GK+TFP  LKQPGPR+   QC I+R+K  ST++LYL L T   ++ GKFLL+A+R+R+   +EY+IS+DA ++S+ S+ Y+GKL S+FLGT F IYD++P +NG
Sbjct:   62 LPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAWREMCKEIVLSPEFCGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAVLADSGKFLLSAKRHRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPSYNG 215          
The following BLAST results are available for this feature:
BLAST of CN185675 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
TLP7_ARATH2.270e-6863.21Tubby-like F-box protein 7 OS=Arabidopsis thaliana... [more]
TLP1_ORYSJ2.781e-5868.18Tubby-like F-box protein 1 OS=Oryza sativa subsp. ... [more]
TLP9_ORYSJ5.799e-5666.01Tubby-like F-box protein 9 OS=Oryza sativa subsp. ... [more]
TLP10_ORYSJ4.595e-5363.40Tubby-like F-box protein 10 OS=Oryza sativa subsp.... [more]
TLP6_ORYSJ1.691e-4756.86Tubby-like F-box protein 6 OS=Oryza sativa subsp. ... [more]
TLP12_ORYSJ3.768e-4757.52Tubby-like F-box protein 12 OS=Oryza sativa subsp.... [more]
TLP11_ORYSJ4.166e-4656.21Tubby-like F-box protein 11 OS=Oryza sativa subsp.... [more]
TLP2_ORYSJ1.583e-4556.21Tubby-like F-box protein 2 OS=Oryza sativa subsp. ... [more]
TLP3_ARATH2.067e-4556.58Tubby-like F-box protein 3 OS=Arabidopsis thaliana... [more]
TLP8_ORYSJ1.026e-4454.55Tubby-like F-box protein 8 OS=Oryza sativa subsp. ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001L08_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001L08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185675 ID=CN185675|Name=CN185675|organism=Citrus sinensis|type=EST|length=651bp
ATTGGGTGGGCGAAAATGTCTCTGAGAAATTCGTGTCTCTCTCGAAGGAT
CTCGAGATCGTTCGGAGAGGCACACAAATCTTCGAAAGAGACCGGACTCG
GCGCCGCTGACGACTCGGTCGTGTCGTCGACCACGTCGGCGTCGATGGAT
TCCGGCGCCGCCGCTGCCCACTCCTCCGGGTCATGGGCCGGGTTGCTGCC
CGAATTGCTAGGGGAGATCATAAGGCGCGTGGAGACCACAGAAGATAGCT
GGCCCCATCGCCAAAACGTTGTCGCTTGTGCTTGCGTTTGTAAGAGATGG
AGGGAAATTACCAAAGATATCGTCAAGTCTCCTTTTCTTAGTGGCAAAAT
TACCTTCCCTTCTTGCCTTAAACAGCCGGGTCCACGCGAGTTCCCTCATC
AATGTCTAATAAGGCGGAATAAGAAGACCTCAACGTTCTACCTCTATCTT
GCTCTTACCCCATCATTTAGCGAAAAGGGGAAGTTTCTTTTAGCAGCTCG
GAGATATAGGCGTGGTGCACACAGTGAGTATATCATATCTCTTGATGCTG
GTGATCTTTCTCAAGGGAGTAATGCATATGTTGGCAAATTAAGTTCTGAT
TTCCTTGGGACAAACTTTACCATTTACGACAGTCGGCCGCCTCACAATGG
T
back to top