CN185671

Overview
NameCN185671
Unique NameCN185671
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length838
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2850 contig Csv1_Contig2850:53..890. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A2_SOLLC (Eukaryotic translation initiation factor 5A-2 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.912e-82
Identity = 147/159 (92.45%), Postives = 152/159 (95.60%), Query Frame = -2
Query:  301 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 777
            MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIFNGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTDENLL Q+KDGF+ GKDLVVSV  AMGEEQINA+KD+G K
Sbjct:    1 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDENLLKQVKDGFQEGKDLVVSVMSAMGEEQINAVKDVGTK 159          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A_MANES (Eukaryotic translation initiation factor 5A OS=Manihot esculenta PE=2 SV=2)

HSP 1 Score: 303.523 bits (776), Expect = 9.490e-82
Identity = 148/159 (93.08%), Postives = 151/159 (94.97%), Query Frame = -2
Query:  301 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 777
            MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIK RPCKV+EVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE GNTKDDLRLPTDENLLSQIKDGF  GKDLVVSV  AMGEE+I +LKDIGPK
Sbjct:    1 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVMEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVSVMSAMGEERICSLKDIGPK 159          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A3_SOLTU (Eukaryotic translation initiation factor 5A-3 OS=Solanum tuberosum GN=EIF5A3 PE=2 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 9.490e-82
Identity = 146/159 (91.82%), Postives = 152/159 (95.60%), Query Frame = -2
Query:  301 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 777
            MSDEEHHFESKADAGASKT+PQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIFNGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTDE+LL Q+KDGF+ GKDLVVSV  AMGEEQINA+KDIG K
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDESLLKQVKDGFQEGKDLVVSVMSAMGEEQINAIKDIGTK 159          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A3_SOLLC (Eukaryotic translation initiation factor 5A-3 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.619e-81
Identity = 148/159 (93.08%), Postives = 150/159 (94.34%), Query Frame = -2
Query:  301 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 777
            MSDEEH FESKADAGASKT+PQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLT+NGNTKDDLRLPTDENLLS IKDGF  GKDLVVSV  AMGEEQINALKDIGPK
Sbjct:    1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTDENLLSLIKDGFAEGKDLVVSVMSAMGEEQINALKDIGPK 159          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A4_SOLTU (Eukaryotic translation initiation factor 5A-4 OS=Solanum tuberosum GN=EIF5A4 PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 8.034e-81
Identity = 146/159 (91.82%), Postives = 151/159 (94.97%), Query Frame = -2
Query:  301 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 777
            MSDEEH FESKADAGASKT+PQQAGTIRK+GYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLT+NGNTKDDLRLPTD++LLSQIKDGF  GKDLVVSV  AMGEEQINALKDIGPK
Sbjct:    1 MSDEEHQFESKADAGASKTYPQQAGTIRKSGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTDDSLLSQIKDGFAEGKDLVVSVMSAMGEEQINALKDIGPK 159          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A2_NICPL (Eukaryotic translation initiation factor 5A-2 OS=Nicotiana plumbaginifolia GN=EIF-5A2 PE=2 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 2.337e-80
Identity = 146/159 (91.82%), Postives = 150/159 (94.34%), Query Frame = -2
Query:  301 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 777
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+NLL+QIKDGF  GKDLVVSV  AMGEEQI ALKDIGPK
Sbjct:    1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A4_SOLLC (Eukaryotic translation initiation factor 5A-4 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 2.584e-79
Identity = 143/159 (89.94%), Postives = 149/159 (93.71%), Query Frame = -2
Query:  301 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 777
            MSDEEHHFESKADAGASKT+PQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIFN KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+ LL+Q+K GFE GKDLV+SV  AMGEEQI A+KDIG K
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDTLLNQVKGGFEEGKDLVLSVMSAMGEEQICAVKDIGTK 159          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A1_SOLTU (Eukaryotic translation initiation factor 5A-1/2 OS=Solanum tuberosum GN=EIF5A1 PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 3.375e-79
Identity = 143/159 (89.94%), Postives = 150/159 (94.34%), Query Frame = -2
Query:  301 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 777
            MSDEEHHFESKADAGASKT+PQQAGTIRK+GYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIFNGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+ LL+Q+K GFE GKDLV+SV  AMGEEQI A+KDIG K
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKSGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDALLNQVKGGFEEGKDLVLSVMSAMGEEQICAVKDIGTK 159          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A2_MEDSA (Eukaryotic translation initiation factor 5A-2 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 9.821e-79
Identity = 142/159 (89.31%), Postives = 149/159 (93.71%), Query Frame = -2
Query:  301 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 777
            MSDEEHHFE  ADAGASKT+PQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIFNGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLT+NG+TKDDL+LPTD++LL+QIKDGF  GKDLVVSV  AMGEEQI ALKDIGPK
Sbjct:    1 MSDEEHHFEPAADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGSTKDDLKLPTDDSLLTQIKDGFADGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of CN185671 vs. ExPASy Swiss-Prot
Match: IF5A1_TOBAC (Eukaryotic translation initiation factor 5A-1 OS=Nicotiana tabacum GN=EIF-5A1 PE=3 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.283e-78
Identity = 141/159 (88.68%), Postives = 148/159 (93.08%), Query Frame = -2
Query:  301 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 777
            MSDEEHHFESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+NLL+ IKDGF  GKDLV+SV  AMGEEQI  +KD+GPK
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDNLLALIKDGFAEGKDLVLSVMSAMGEEQICGIKDVGPK 159          
The following BLAST results are available for this feature:
BLAST of CN185671 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
IF5A2_SOLLC1.912e-8292.45Eukaryotic translation initiation factor 5A-2 OS=S... [more]
IF5A_MANES9.490e-8293.08Eukaryotic translation initiation factor 5A OS=Man... [more]
IF5A3_SOLTU9.490e-8291.82Eukaryotic translation initiation factor 5A-3 OS=S... [more]
IF5A3_SOLLC1.619e-8193.08Eukaryotic translation initiation factor 5A-3 OS=S... [more]
IF5A4_SOLTU8.034e-8191.82Eukaryotic translation initiation factor 5A-4 OS=S... [more]
IF5A2_NICPL2.337e-8091.82Eukaryotic translation initiation factor 5A-2 OS=N... [more]
IF5A4_SOLLC2.584e-7989.94Eukaryotic translation initiation factor 5A-4 OS=S... [more]
IF5A1_SOLTU3.375e-7989.94Eukaryotic translation initiation factor 5A-1/2 OS... [more]
IF5A2_MEDSA9.821e-7989.31Eukaryotic translation initiation factor 5A-2 OS=M... [more]
IF5A1_TOBAC1.283e-7888.68Eukaryotic translation initiation factor 5A-1 OS=N... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001L05_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001L05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185671 ID=CN185671|Name=CN185671|organism=Citrus sinensis|type=EST|length=838bp
TTTTTTTTTCCCGAAGCTGTAAATTGCATGTTTGAAACAACCAAAAGGTG
CTTCCATGTGTATATACAGTCACGTTGGCGGATACAACTTCTGCACACCG
AGAACAACCATGTTTCAACTTTCAAGCAATCAAACAGAATAAAAATACTG
TCGATAGAAAACAATTAATAATATGGTAAGAGTCATTTTATATGAAATGA
TGGCATTCATCTTGAAACCGGACACCAGTAAAGCTACACTACTATCCACC
TTCCCACAGCTTTCAGCAATCTGCATTCTCGATCAAGCAAAAGTCTTTTA
CTTGGGGCCAATGTCCTTCAGGGCATTGATCTGCTCCTCTCCCATAGCAC
ACTGAACTGAGACAACCAGATCTTTCCCACTCTCAAATCCATCCTTGATC
TGTGAAAGCAGATTTTCATCAGTTGGAAGTCTCAGGTCATCCTTGGTATT
GCCATTCTCAGTCAGCAGGCTAACAAATCCATCCTCAGAGATATCAATCA
GCTGGTAGTCAGTGCGAGTGACATGAGGAACATCACAGTTGTGGGAAGAG
GGAACAATATCCTCAAGCTTCTTGCCATTGAAGATGTCAATTCCTACAAA
GTGACACTTAGCATGACCGTGCTTTCCAGTCTTGGAAGTTGAAACCTCAA
CAACCTTGCAAGGACGACCTTTGATGACGATATAACCGTTTTTGCGGATG
GTTCCGGCCTGCTGAGGAAATGTCTTGGAGGCGCCGGCGTCGGCCTTCGA
CTCAAAGTGGTGCTCTTCGTCCGACATATCGTCTGGTTCCTGCGATTCAC
AATTAGAGCTTCGACAACCAAATTTTGGTAGAATCGAA
back to top