CN185570

Overview
NameCN185570
Unique NameCN185570
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length359
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2579 contig Csv1_Contig2579:440..798. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185570 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.254e-23
Identity = 46/66 (69.70%), Postives = 54/66 (81.82%), Query Frame = 1
Query:   55 MSDTCGNCDCADGSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 252
            MSDTCGNCDCAD +QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of CN185570 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.369e-19
Identity = 44/65 (67.69%), Postives = 49/65 (75.38%), Query Frame = 1
Query:   55 MSDTCGNCDCADGSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 249
            MSD CGNCDCAD SQCVKKG+S   D VETD S++   VVM V AAE+ G CKCG +C CVNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNS--IDIVETDKSYIED-VVMGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of CN185570 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 9.801e-19
Identity = 39/64 (60.94%), Postives = 47/64 (73.44%), Query Frame = 1
Query:   64 TCGNCDCADGSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCGS 255
            TCGNCDC D SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of CN185570 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.174e-17
Identity = 38/65 (58.46%), Postives = 45/65 (69.23%), Query Frame = 1
Query:   55 MSDTCGNCDCADGSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 249
            MS  C NCDC+D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of CN185570 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.174e-17
Identity = 39/66 (59.09%), Postives = 46/66 (69.70%), Query Frame = 1
Query:   55 MSDTCGNCDCADGSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 252
            MS  C NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of CN185570 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.325e-15
Identity = 36/66 (54.55%), Postives = 42/66 (63.64%), Query Frame = 1
Query:   55 MSDTCGNCDCADGSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 252
            MSD CGNCDCAD SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CN185570 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.325e-15
Identity = 36/66 (54.55%), Postives = 42/66 (63.64%), Query Frame = 1
Query:   55 MSDTCGNCDCADGSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 252
            MSD CGNCDCAD SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CN185570 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.115e-13
Identity = 33/66 (50.00%), Postives = 40/66 (60.61%), Query Frame = 1
Query:   55 MSDTCGNCDCADGSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 252
            MSD CGNCDCAD SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of CN185570 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 8.037e-13
Identity = 32/66 (48.48%), Postives = 40/66 (60.61%), Query Frame = 1
Query:   55 MSDTCGNCDCADGSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 252
            MSD CG+CDCAD SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of CN185570 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA2.254e-2369.70Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_ACTDE3.369e-1967.69Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_MUSAC9.801e-1960.94Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_PRUAV9.174e-1758.46Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO9.174e-1759.09Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ1.325e-1554.55Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI1.325e-1554.55Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ2.115e-1350.00Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI8.037e-1348.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001I19_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001I19, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185570 ID=CN185570|Name=CN185570|organism=Citrus sinensis|type=EST|length=359bp
AGTAAAGAGCCCTCTATTTCCAGTTTTAAGTTCTAAGTTCTAAGCTCAAT
CAACATGTCGGACACCTGCGGCAACTGCGACTGCGCTGACGGGAGCCAGT
GTGTGAAGAAGGGAAGCAGCTATGCTGCTGACTTCGTCGAGACTGACTTG
AGCTTTGTCAGCACCGTTGTTGTCATGGACGTTCAGGCTGCTGAGGCTGA
AGGTAACTGCAAGTGCGGCCCCACCTGCGCTTGTGTGAACTGCACTTGTG
GTAGTCACTAATAAGCAAACACATGCCGCAAAAAATAAGAAGCTGCAAGT
GTGCCTAAATATTGTGGGGGTTAAGAATAATGTAAGGGTGATTAAAAAAA
AAAAAAAAA
back to top