CN185565

Overview
NameCN185565
Unique NameCN185565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length727
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185565 vs. ExPASy Swiss-Prot
Match: COG6_BOVIN (Conserved oligomeric Golgi complex subunit 6 OS=Bos taurus GN=COG6 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.172e-41
Identity = 91/229 (39.74%), Postives = 143/229 (62.45%), Query Frame = 3
Query:   51 LSRKLKKVLESRTETP-DLLASLKTLSTFYEENTPHARRNLRSTIEKRALSINLDFXXXXXXXXXXXXXVEEEVNSLAECCDRIEKALNSCNATTGNIIETTERLKRDLDVNTQRQEIVSCFLRDYQLSNEEINALR---DEDLDESFFKALAHVQEIHANCKVLLRTHHQRAGLELMDMMAMYQEGAYERLCRWVQAECRKLGDTENPEVGELLKTAVRCLKERPVLF 725
            LSRKL+K+L++R +   D+L +LK LSTF+ EN+   RRNLR  IE+R+L+IN +F             + E+V +++ CC  +   L +    T ++I  T +L+ +      R ++   FL  +QL+++E++ LR   +  + E FFKAL  V++IH + KVLLRT+ Q AGLE+M+ MA+ QE +YERL RW Q+ECR L   E+ ++  +L  A+  L++RPVL+
Sbjct:   35 LSRKLRKILDTRLDNDKDMLEALKALSTFFVENSLRTRRNLRGDIERRSLAINEEFVSIFKEVKEELESIHEDVQAMSSCCQDMTSRLQAAKEQTQDLIVKTTKLQAESQRLEIRAQVADAFLSKFQLTSDEMSLLRGTREGPITEDFFKALGRVKQIHNDVKVLLRTNQQTAGLEIMEQMALLQETSYERLYRWAQSECRTL-TQESCDISPVLTQAMEALQDRPVLY 262          
BLAST of CN185565 vs. ExPASy Swiss-Prot
Match: COG6_MOUSE (Conserved oligomeric Golgi complex subunit 6 OS=Mus musculus GN=Cog6 PE=2 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 2.837e-41
Identity = 94/229 (41.05%), Postives = 141/229 (61.57%), Query Frame = 3
Query:   51 LSRKLKKVLESRTETP-DLLASLKTLSTFYEENTPHARRNLRSTIEKRALSINLDFXXXXXXXXXXXXXVEEEVNSLAECCDRIEKALNSCNATTGNIIETTERLKRDLDVNTQRQEIVSCFLRDYQLSNEEINALRDE---DLDESFFKALAHVQEIHANCKVLLRTHHQRAGLELMDMMAMYQEGAYERLCRWVQAECRKLGDTENPEVGELLKTAVRCLKERPVLF 725
            LSRKL K+LE+R E   ++L +LK LS F+ EN+   RRNLR  IE+R+L+IN +F             + E+V +++ CC  +   L +    T ++I  T +L+ +      R ++V  FL  +QL+++E++ LR      + E FFKAL  V++IH + KVLLRT+ Q AGLE+M+ MA+ QE AYERL RW Q+ECR L   E+ +V  +L  A+  L++RPVL+
Sbjct:   35 LSRKLHKILETRLENDKEMLEALKALSAFFVENSLRTRRNLRGDIERRSLAINEEFVNIFKDVKEELESINEDVQAMSSCCQDMTSRLQAAKEQTQDLIVKTTKLQAENQRLEIRAQVVDAFLAKFQLTSDEMSLLRGTRGGPVTEDFFKALGRVKQIHNDVKVLLRTNQQTAGLEIMEQMALLQETAYERLYRWAQSECRAL-TQESCDVSAVLSQAMEALQDRPVLY 262          
BLAST of CN185565 vs. ExPASy Swiss-Prot
Match: COG6_HUMAN (Conserved oligomeric Golgi complex subunit 6 OS=Homo sapiens GN=COG6 PE=2 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 3.705e-41
Identity = 92/229 (40.17%), Postives = 142/229 (62.01%), Query Frame = 3
Query:   51 LSRKLKKVLESRTETP-DLLASLKTLSTFYEENTPHARRNLRSTIEKRALSINLDFXXXXXXXXXXXXXVEEEVNSLAECCDRIEKALNSCNATTGNIIETTERLKRDLDVNTQRQEIVSCFLRDYQLSNEEINALR---DEDLDESFFKALAHVQEIHANCKVLLRTHHQRAGLELMDMMAMYQEGAYERLCRWVQAECRKLGDTENPEVGELLKTAVRCLKERPVLF 725
            LSRKL K+LE+R +   ++L +LK LSTF+ EN+   RRNLR  IE+++L+IN +F             + E+V +++ CC  +   L +    T ++I  T +L+ +      R ++   FL  +QL+++E++ LR   +  + E FFKAL  V++IH + KVLLRT+ Q AGLE+M+ MA+ QE AYERL RW Q+ECR L   E+ +V  +L  A+  L++RPVL+
Sbjct:   35 LSRKLHKILETRLDNDKEMLEALKALSTFFVENSLRTRRNLRGDIERKSLAINEEFVSIFKEVKEELESISEDVQAMSNCCQDMTSRLQAAKEQTQDLIVKTTKLQSESQKLEIRAQVADAFLSKFQLTSDEMSLLRGTREGPITEDFFKALGRVKQIHNDVKVLLRTNQQTAGLEIMEQMALLQETAYERLYRWAQSECRTL-TQESCDVSPVLTQAMEALQDRPVLY 262          
BLAST of CN185565 vs. ExPASy Swiss-Prot
Match: COG6_RAT (Conserved oligomeric Golgi complex subunit 6 OS=Rattus norvegicus GN=Cog6 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.408e-40
Identity = 93/229 (40.61%), Postives = 139/229 (60.70%), Query Frame = 3
Query:   51 LSRKLKKVLESRTETP-DLLASLKTLSTFYEENTPHARRNLRSTIEKRALSINLDFXXXXXXXXXXXXXVEEEVNSLAECCDRIEKALNSCNATTGNIIETTERLKRDLDVNTQRQEIVSCFLRDYQLSNEEINALRDE---DLDESFFKALAHVQEIHANCKVLLRTHHQRAGLELMDMMAMYQEGAYERLCRWVQAECRKLGDTENPEVGELLKTAVRCLKERPVLF 725
            LSRKL K+LE+R E   ++L +LK LS F+ EN+   RRNLR  IE+R+L+IN +F             + E+V +++ CC  +   L +    T ++I  T +L+ +      R ++   FL  +QL+++E+  LR      + E FFKAL  V++IH + KVLLRT+ Q AGLE+M+ MA+ QE AYERL RW Q+ECR L   E+ +V  +L  A+  L++RPVL+
Sbjct:   35 LSRKLHKILETRLENDKEMLEALKALSAFFVENSLRTRRNLRGDIERRSLAINEEFVSIFKDVKEELESINEDVQAMSSCCQDMTSRLQAAKEQTQDLIVKTTKLQAENQRLEIRAQVADAFLSKFQLTSDEMTLLRGTRGGPVTEDFFKALGRVKQIHNDVKVLLRTNQQTAGLEIMEQMALLQETAYERLYRWAQSECRAL-TQESCDVSAVLTQAMEALQDRPVLY 262          
BLAST of CN185565 vs. ExPASy Swiss-Prot
Match: COG6_DROME (Conserved oligomeric Golgi complex subunit 6 OS=Drosophila melanogaster GN=CG1968 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.038e-35
Identity = 85/230 (36.96%), Postives = 135/230 (58.70%), Query Frame = 3
Query:   51 LSRKLKKVLESRTETP-DLLASLKTLSTFYEENTPHARRNLRSTIEKRALSINLDFXXXXXXXXXXXXXVEEEVNSLAECCDRIEKALNSCNATTGNIIETTERLKRDLDVNTQRQEIVSCFLRDYQLSNEE----INALRDEDLDESFFKALAHVQEIHANCKVLLRTHHQRAGLELMDMMAMYQEGAYERLCRWVQAECRKLGDTENPEVGELLKTAVRCLKERPVLF 725
            + +++ K+LE+R E+  D L +L  LSTF+ ENT   RRNLRS IE R++ IN +F             V E+++++A   + ++  L +  A T ++I+ T  ++R+ D     ++I   FL  +QLS  E      A +D  +   FF+ L  VQ IHA+C++L++  +Q A +++M+ M ++QEGA ERL RW Q  CR L   EN E+G L+  A+  L++RPVLF
Sbjct:   14 IQKRVNKILEARLESDKDTLDALSGLSTFFTENTLQNRRNLRSQIEHRSVGINENFLKAFRQVKLSLDAVCEDLDTMATSVETMKSDLETSKALTKDLIKQTNTMQRERDRLEVHKQIAQAFLARFQLSGAEHQLLYGAAKDAPIVADFFRVLDRVQSIHADCRLLMQCGYQTAAIDIMEEMTLHQEGALERLYRWTQNHCRSL---ENNEIGPLIVEAMSRLQDRPVLF 240          
BLAST of CN185565 vs. ExPASy Swiss-Prot
Match: COG6_ASPOR (Conserved oligomeric Golgi complex subunit 6 OS=Aspergillus oryzae GN=cog6 PE=3 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.367e-26
Identity = 65/227 (28.63%), Postives = 116/227 (51.10%), Query Frame = 3
Query:   51 LSRKLKKVLESRTETPDLLASLKTLSTFYEENTPHARRNLRSTIEKRALSINLDFXXXXXXXXXXXXXVEEEVNSLAECCDRIEKALNSCNATTGNIIETTERLKRDLDVNTQRQEIVSCFLRDYQLSNEEINALR--DEDLDESFFKALAHVQEIHANCKVLLRTHHQRAGLELMDMMAMYQEGAYERLCRWVQAECRKLGDTENPEVGELLKTAVRCLKERPVLF 725
            L+ +L  VL +     D+  +L+TLS     NTP  RR LR  ++K  +  N +              +   + SL + CD + K ++     T  ++E    L         +Q+++  F + + + +++I  L   ++ +++ FF+ LA V+++H +C+ LL   +QR GLELMD  +     AY++L RW+Q E + L + E+P +   ++ A+R L ERP LF
Sbjct:  102 LTNRLTSVLSASYADSDIRDALETLSLRDIHNTPEVRRQLRLDVQKEVVDCNAEIVRDFGKVAEQLKRIGTVITSLNQTCDEMRKHISLARQDTAPVLEEASTLMNQKKEAETKQQLLDAFTKHFVVPDDDILVLTSLEDPINDQFFEVLARVKQVHRDCEALLGGENQRLGLELMDKSSRNLNSAYQKLYRWIQKEFKSL-NLEDPRISSSIRRALRVLAERPSLF 327          
BLAST of CN185565 vs. ExPASy Swiss-Prot
Match: COG6_ASPCL (Conserved oligomeric Golgi complex subunit 6 OS=Aspergillus clavatus GN=cog6 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.182e-25
Identity = 66/227 (29.07%), Postives = 115/227 (50.66%), Query Frame = 3
Query:   51 LSRKLKKVLESRTETPDLLASLKTLSTFYEENTPHARRNLRSTIEKRALSINLDFXXXXXXXXXXXXXVEEEVNSLAECCDRIEKALNSCNATTGNIIETTERLKRDLDVNTQRQEIVSCFLRDYQLSNEEINALR--DEDLDESFFKALAHVQEIHANCKVLLRTHHQRAGLELMDMMAMYQEGAYERLCRWVQAECRKLGDTENPEVGELLKTAVRCLKERPVLF 725
            LS +L  VL +     D+  +L+TLS     NT   RR LR  ++K  +  N +              +   ++SL + C+ + + +      T  ++E    L      +  +Q+++  F + + +  EE+  L   +E +D+ FF  LA V+++H +C+VLL   +QR GLELM+  +     AY++L RW+Q E + L + E+P +   ++ A+R L ERP LF
Sbjct:   36 LSNRLTSVLSASYADSDIRDALETLSLRGIHNTAETRRQLRLDVQKEVVDSNAEIVRDFGTVAEQLQRIGAVISSLNQTCEEMRQHIFLAKQDTTPVLEEASALVSQKQESETKQQLLDAFAKHFIIPEEELPVLTSLEEPIDDHFFNVLARVKQVHHDCEVLLEGENQRLGLELMEKSSRTLNSAYQKLFRWIQKEFQSL-NLEDPRISSSIRRALRVLAERPSLF 261          
BLAST of CN185565 vs. ExPASy Swiss-Prot
Match: COG6_ASPTN (Conserved oligomeric Golgi complex subunit 6 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cog6 PE=3 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.723e-25
Identity = 67/227 (29.52%), Postives = 116/227 (51.10%), Query Frame = 3
Query:   51 LSRKLKKVLESRTETPDLLASLKTLSTFYEENTPHARRNLRSTIEKRALSINLDFXXXXXXXXXXXXXVEEEVNSLAECCDRIEKALNSCNATTGNIIETTERLKRDLDVNTQRQEIVSCFLRDYQLSNEEINALR--DEDLDESFFKALAHVQEIHANCKVLLRTHHQRAGLELMDMMAMYQEGAYERLCRWVQAECRKLGDTENPEVGELLKTAVRCLKERPVLF 725
            LS +L  VL +     D+  +L+TLS     NT   RR LR  ++K  +  N +              +   ++SL + C+ ++K +      T  ++E    L         +Q+++  F + + +S E++  L   +E +DE FF  L+ V+++H +C+VLL   +QR GLELM+  +     AY++L +W+Q E R L + E+P +   ++ A+R L ERP LF
Sbjct:   37 LSNRLTSVLSASYADSDIRDALETLSLRGIHNTAEVRRQLRLDVQKEVVDSNAEIVRDFGKVAEQLKRIGTVISSLNQTCEEMKKHIVLAKQDTTPVLEEAASLMNQKREAETKQQLLDAFTKHFIVSEEDLLILTSAEEPIDERFFDLLSRVKQVHRDCEVLLGGENQRLGLELMEKSSRNLNSAYQKLYKWIQKEFRSL-NLEDPRISSSIRRALRVLAERPSLF 262          
BLAST of CN185565 vs. ExPASy Swiss-Prot
Match: COG6_PHANO (Conserved oligomeric Golgi complex subunit 6 OS=Phaeosphaeria nodorum GN=COG6 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.862e-25
Identity = 67/230 (29.13%), Postives = 115/230 (50.00%), Query Frame = 3
Query:   42 APGLSRKLKKVLESRTETPDLLASLKTLSTFYEENTPHARRNLRSTIEKRALSINLDFXXXXXXXXXXXXXVEEEVNSLAECCDRIEKALNSCNATTGNIIETTERLKRDLDVNTQRQEIVSCFLRDYQLSNEEINALRD--EDLDESFFKALAHVQEIHANCKVLLRTHHQRAGLELMDMMAMYQEGAYERLCRWVQAECRKLGDTENPEVGELLKTAVRCLKERPVLF 725
            A  LS ++  VL +     ++  +L+TL T    NT   RR +R  ++K  +  N +              +   ++SL   C  +   + + N  TG ++E    L         +Q+I+  F   + +S+EE   L    E ++E FF+ L  V++IH +C+VLL T  QR GLE+++  +     A+++L RW+Q E + L D ENP++   ++ ++R L ERP LF
Sbjct:   32 ANALSSRITSVLSASYADLEIRDALETLDTRGVRNTAETRRQIRLDVQKEVIECNGEIVKDFGQVAEQLKRIGTAISSLNSYCADMRSHIAAANKETGPVLEEATGLINQRKQVESKQQILQAFNSHFLISDEEATVLTSTAEPVNEEFFQVLTRVKKIHHDCQVLLGTEDQRLGLEILEQSSKQLNAAFQKLYRWIQREFKTL-DLENPQISASVRRSLRVLAERPTLF 260          
BLAST of CN185565 vs. ExPASy Swiss-Prot
Match: COG6_ASPFU (Conserved oligomeric Golgi complex subunit 6 OS=Aspergillus fumigatus GN=cog6 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 6.350e-25
Identity = 64/227 (28.19%), Postives = 116/227 (51.10%), Query Frame = 3
Query:   51 LSRKLKKVLESRTETPDLLASLKTLSTFYEENTPHARRNLRSTIEKRALSINLDFXXXXXXXXXXXXXVEEEVNSLAECCDRIEKALNSCNATTGNIIETTERLKRDLDVNTQRQEIVSCFLRDYQLSNEEINALR--DEDLDESFFKALAHVQEIHANCKVLLRTHHQRAGLELMDMMAMYQEGAYERLCRWVQAECRKLGDTENPEVGELLKTAVRCLKERPVLF 725
            LS +L  VL +     D+  +L+TLS     NT   RR LR  ++K  +  N +              +   ++SL + C+ + + +      T  +IE    L      +  +Q+++  F++ + +S +++  L   +E +D+ FF  L  V+++H +C+VLL   +QR GLELM+  +     AY++L RW+Q + + L + E+P +   ++ A+R L ERP LF
Sbjct:   36 LSNRLTSVLSASYADSDIRDALETLSLRGVHNTAETRRQLRLDVQKEVVECNAEIVRDFGKVAEQLQRIGTVISSLNQTCEEMRQHIVRAKQDTAPVIEEASALMNQKKESETKQQLLDAFVKHFIVSEDDLLVLTSAEEPIDDRFFNVLDRVKQVHHDCEVLLGGENQRLGLELMEKSSRNLNSAYQKLFRWIQKKFKSL-NLEDPRISSSIRRALRVLAERPSLF 261          
The following BLAST results are available for this feature:
BLAST of CN185565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
COG6_BOVIN2.172e-4139.74Conserved oligomeric Golgi complex subunit 6 OS=Bo... [more]
COG6_MOUSE2.837e-4141.05Conserved oligomeric Golgi complex subunit 6 OS=Mu... [more]
COG6_HUMAN3.705e-4140.17Conserved oligomeric Golgi complex subunit 6 OS=Ho... [more]
COG6_RAT1.408e-4040.61Conserved oligomeric Golgi complex subunit 6 OS=Ra... [more]
COG6_DROME3.038e-3536.96Conserved oligomeric Golgi complex subunit 6 OS=Dr... [more]
COG6_ASPOR3.367e-2628.63Conserved oligomeric Golgi complex subunit 6 OS=As... [more]
COG6_ASPCL2.182e-2529.07Conserved oligomeric Golgi complex subunit 6 OS=As... [more]
COG6_ASPTN3.723e-2529.52Conserved oligomeric Golgi complex subunit 6 OS=As... [more]
COG6_PHANO4.862e-2529.13Conserved oligomeric Golgi complex subunit 6 OS=Ph... [more]
COG6_ASPFU6.350e-2528.19Conserved oligomeric Golgi complex subunit 6 OS=As... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001I15_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001I15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185565 ID=CN185565|Name=CN185565|organism=Citrus sinensis|type=EST|length=727bp
GCAGGGGCCAGTCTGTTCGGGGAGAATCGGAAATGGCATTAGCGCCGGGG
CTTTCACGGAAGCTGAAGAAAGTACTAGAATCAAGAACAGAAACTCCCGA
TCTGCTAGCTTCGCTCAAAACGCTTTCTACTTTCTACGAAGAAAACACTC
CACACGCGCGTCGCAACCTCAGATCCACCATCGAAAAGCGCGCACTCTCC
ATCAATCTCGATTTCCTCCAAGCCTCAAGCGCCGCTCAACAAGCTCTGGA
TCAAGTTGAAGAGGAGGTTAATTCGCTCGCTGAATGCTGTGACAGGATTG
AGAAGGCATTGAATAGTTGTAATGCTACCACTGGTAATATTATCGAAACC
ACAGAGAGGCTCAAGCGGGACCTTGATGTGAATACACAGAGACAAGAGAT
TGTTTCATGCTTTCTTCGTGATTATCAGCTCTCTAATGAAGAGATAAATG
CACTGAGAGACGAAGACCTAGATGAAAGTTTCTTTAAGGCGCTTGCACAT
GTTCAAGAAATTCACGCCAACTGCAAAGTTCTGTTAAGGACACATCACCA
GCGTGCAGGTTTGGAGCTGATGGATATGATGGCTATGTACCAAGAAGGAG
CCTATGAGCGCCTTTGCAGGTGGGTTCAGGCAGAGTGTAGGAAACTGGGT
GACACTGAGAATCCTGAAGTTGGTGAACTTTTGAAAACAGCAGTTCGATG
CCTCAAGGAGAGGCCTGTCCTTTTCAA
back to top