CN185546

Overview
NameCN185546
Unique NameCN185546
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length760
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10630 contig Csv1_Contig10630:554..1313. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185546 vs. ExPASy Swiss-Prot
Match: SFC1_YEAST (Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae GN=SFC1 PE=1 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 2.236e-23
Identity = 72/186 (38.71%), Postives = 93/186 (50.00%), Query Frame = -2
Query:  220 VTPFEVVKIRLQQQRGLSLELL---KYKGPIHCARMIIREEGLFGLWAGAAPTVMRNGTNQAAMFTAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAI---RTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYERRYLRN 759
            V P EVVKIRLQ Q     E     KY   IH A  I++EEG+  L+ G + T  R  TNQ A FT  +     L   H+ D  VL  W++   G ++G  GP    P D +KTRL        E K  GM   I     +  EEG  AL+KG+ PR+MR+ PGQA+ + V +     Y R +L N
Sbjct:  129 VNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMD--VLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLE-KQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE-----YVREHLEN 306          
BLAST of CN185546 vs. ExPASy Swiss-Prot
Match: ODC_HUMAN (Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.946e-20
Identity = 65/183 (35.52%), Postives = 91/183 (49.73%), Query Frame = -2
Query:  229 VTPFEVVKIRLQQQRGLSLELLKYKGPIHCARMIIREEG--LFGLWAGAAPTVMRNGTNQAAMF----TAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYERRY 759
            V PFEVVK+ LQ  R    E       +  AR II++EG  L GL  G   T+ R+G      F      KN   V           +L+ W+    G L+GT   V   PFDV K+R+       GE+KY+     + T+Y EEG+LAL+KGLLP++MR+ PG A+M  V +    + +  +
Sbjct:  127 VNPFEVVKVGLQANRNTFAE---QPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPV-------NKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW 299          
BLAST of CN185546 vs. ExPASy Swiss-Prot
Match: MCFZ_DICDI (Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.148e-19
Identity = 62/175 (35.43%), Postives = 90/175 (51.43%), Query Frame = -2
Query:  238 VTPFEVVKIRLQQQRGLSLELLKYKGPIHCARMIIREEGLFGLWAGAAPTVMRNGTNQAAMFTAKNAFDVLLWKKHEGDGKVLQP-WQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYE 759
            V P E++K+R   Q     E  K  G +   R ++REEG  GL+ G + T++R  TN    F    A    L     GD  V  P WQ++ +G +AGTA  +   P D +KTR+  Q +       +  +  +R IY E G+   W G++PR++R+ PGQAI WAV + V G  E
Sbjct:  137 VIPCELLKVRHMTQ-----EHNKSFGTVF--RDVLREEGFQGLYKGGSATLLRQITNHMIRFPTFYAISDYL---KGGDHSVHLPVWQNLSAGAIAGTASTLFNNPLDTIKTRMQKQGQN------QTTMQVVRGIYQETGVKGYWAGVIPRILRVAPGQAITWAVVELVMGILE 295          
BLAST of CN185546 vs. ExPASy Swiss-Prot
Match: ODC_SCHPO (Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe GN=SPAC328.09 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.363e-19
Identity = 59/182 (32.42%), Postives = 94/182 (51.65%), Query Frame = -2
Query:  217 VTPFEVVKIRLQQQRGLSLELLKYKGPIHCARMIIREEGLFGLWAGAAPTVMRNGTNQAAMFTAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGEL-KYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYERRYLRNA 759
            V PFE++KIRLQ  +  S    KY G + C   I+++E +  L+ G   T+ R+    A  F         L       G++     ++I+G + G  G   + PFDV+K+R+    R  G++ KY     A+ T+  EEG  AL+KG +P+++R+ PG  I+  V + V  FY+R  + NA
Sbjct:  122 VVPFELMKIRLQDVKNAS----KYNGTVDCFTKIVKQERILALYNGFEATMWRHVVWNAGYFGVIQKIRNSLTPASSRIGEIRN---NLIAGTIGGIFGTFLSTPFDVIKSRIQTVPRIAGQVPKYNWAYPALVTVAREEGFTALYKGFVPKVLRLGPGGGILLVVFNSVIEFYKRCLVHNA 296          
BLAST of CN185546 vs. ExPASy Swiss-Prot
Match: ODC_PONAB (Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.658e-18
Identity = 64/183 (34.97%), Postives = 89/183 (48.63%), Query Frame = -2
Query:  229 VTPFEVVKIRLQQQRGLSLELLKYKGPIHCARMIIREEG--LFGLWAGAAPTVMRNGTNQAAMF----TAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYERRY 759
            V PFEVVK+ LQ  R       K    +  AR II++EG  L GL  G   T+ R+G      F      KN   V            L+  +    G L+GT   V   PFDV K+R+       GE+KY+     + T+Y EEG+LAL+KGLLP++MR+ PG A+M  V +    + +  +
Sbjct:  127 VNPFEVVKVGLQANRNT---FAKQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPV-------NKDPTLEFLRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW 299          
BLAST of CN185546 vs. ExPASy Swiss-Prot
Match: ODC_RAT (Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.165e-18
Identity = 64/180 (35.56%), Postives = 91/180 (50.56%), Query Frame = -2
Query:  229 VTPFEVVKIRLQQQRGLSLELLKYKGPIHCARMIIREEG--LFGLWAGAAPTVMRNGTNQAAMFTAK-NAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYERRY 759
            V PFEVVK+ LQ  R +  E          AR II++EG    GL  G   T+ R+G      F    N  D +   K       L+  +    GF++GT G V   PFDV K+R+       GE+KY+G    + T+Y EEG+LAL+KGLLP++MR+ PG  +M  V +    + +  +
Sbjct:  126 VNPFEVVKVGLQVNRNMFTE---QPSTFAYARQIIKKEGWGFQGLNKGFTATLGRHGIFNMTYFGFYYNVKDNIPSSKDP----TLEFLRKFGIGFVSGTVGSVFNIPFDVAKSRIQGPQPVPGEIKYRGCFKTMETVYREEGILALYKGLLPKVMRLGPGGGVMLLVYEYTYAWLQENW 298          
BLAST of CN185546 vs. ExPASy Swiss-Prot
Match: ODC_BOVIN (Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.824e-18
Identity = 65/183 (35.52%), Postives = 89/183 (48.63%), Query Frame = -2
Query:  229 VTPFEVVKIRLQQQRGLSLELLKYKGPIHCARMIIREEGLF--GLWAGAAPTVMRNGTNQAAMF----TAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYERRY 759
            V PFEVVK+ LQ  R    E       +  AR II++EGL   GL  G   T+ R+G      F      KN   V            L+  +    G L+GT   V   PFDV K+R+       GE+KYK     + T+Y EEG+LAL+KGLLP++MR+ PG A+M  V +    + +  +
Sbjct:  127 VNPFEVVKVGLQANRNRFTE---QPSTMSYARHIIKKEGLGLGGLNKGFTATLGRHGVFNMVYFGFYFNVKNIIPV-------NKDPTLEFLRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYKTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW 299          
BLAST of CN185546 vs. ExPASy Swiss-Prot
Match: ODC2_YEAST (Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae GN=ODC2 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 6.300e-18
Identity = 54/178 (30.34%), Postives = 90/178 (50.56%), Query Frame = -2
Query:  241 VTPFEVVKIRLQQQRGLSLELLKYKGPIHCARMIIREEGLFGLWAGAAPTVMRN----GTNQAAMFTAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELK-YKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFY 759
            + PFE++KIR+Q  +        Y GP+ C +  I+ EG+ GL+ G   T+ RN    G     ++  +N+  V   K  +           +I+G + GT G +   PFDVVK+R+ +       +K Y   + ++  IY EEG  AL+KG +P++ R+ PG ++M  V   +  F+
Sbjct:  136 IVPFELIKIRMQDVKS------SYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRN-------DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300          
BLAST of CN185546 vs. ExPASy Swiss-Prot
Match: ODC_MOUSE (Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.404e-17
Identity = 61/179 (34.08%), Postives = 91/179 (50.84%), Query Frame = -2
Query:  229 VTPFEVVKIRLQQQRGLSLELLKYKGPIHCARMIIREEGLF--GLWAGAAPTVMRNGTNQAAMFTAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYERRY 759
            V PFEVVK+ LQ  R L  E          AR II++EGL   GL  G   T+ R+G      F   +    ++    +   + L+ +     GF++GT G V   PFDV K+R+       GE+KY+     +  IY EEG+LAL+KGL+P++MR+ PG  +M  V +    + +  +
Sbjct:  126 VNPFEVVKVGLQVNRNLFKE---QPSTFAYARQIIKKEGLGFQGLNKGLTATLGRHGIFNMVYFGFYHNVKNIIPSSKDPTLEFLRKFGI---GFVSGTMGSVFNIPFDVAKSRIQGPQPVPGEIKYRSCFKTMEMIYREEGILALYKGLVPKVMRLGPGGGVMLLVYEYTYAWLQENW 298          
BLAST of CN185546 vs. ExPASy Swiss-Prot
Match: ODC_DICDI (Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.084e-17
Identity = 59/169 (34.91%), Postives = 83/169 (49.11%), Query Frame = -2
Query:  253 VTPFEVVKIRLQQQRGLSLELLKYKGPIHCARMIIREEGLFGLWAGAAPTVMRNGTNQAAMFTAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQV 759
            V PFE+VKIRLQ +        KY   + C     R EGL G + G   T+ R+       F   +     L K     G ++    + I+G LAGT G +   P DVVK+R+  Q   G   KY   + +I T+  EEG  AL+KG LP+++R+ PG  I+  V + V
Sbjct:  134 VVPFELVKIRLQAKENAG----KYTSTMDCVNKTFRAEGLSGFFKGLESTIWRHACWNGGYFGLIHTIKSALPKPTTEQGVLVN---NFIAGGLAGTFGTMLNTPADVVKSRIQNQVGAG---KYNWCIPSILTVAREEGFSALYKGFLPKVLRLGPGGGILLVVNEFV 292          
The following BLAST results are available for this feature:
BLAST of CN185546 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 115
Match NameE-valueIdentityDescription
SFC1_YEAST2.236e-2338.71Succinate/fumarate mitochondrial transporter OS=Sa... [more]
ODC_HUMAN3.946e-2035.52Mitochondrial 2-oxodicarboxylate carrier OS=Homo s... [more]
MCFZ_DICDI1.148e-1935.43Mitochondrial substrate carrier family protein Z O... [more]
ODC_SCHPO4.363e-1932.42Probable mitochondrial 2-oxodicarboxylate carrier ... [more]
ODC_PONAB1.658e-1834.97Mitochondrial 2-oxodicarboxylate carrier OS=Pongo ... [more]
ODC_RAT2.165e-1835.56Mitochondrial 2-oxodicarboxylate carrier OS=Rattus... [more]
ODC_BOVIN4.824e-1835.52Mitochondrial 2-oxodicarboxylate carrier OS=Bos ta... [more]
ODC2_YEAST6.300e-1830.34Mitochondrial 2-oxodicarboxylate carrier 2 OS=Sacc... [more]
ODC_MOUSE1.404e-1734.08Mitochondrial 2-oxodicarboxylate carrier OS=Mus mu... [more]
ODC_DICDI4.084e-1734.91Probable mitochondrial 2-oxodicarboxylate carrier ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001I04_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001I04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185546 ID=CN185546|Name=CN185546|organism=Citrus sinensis|type=EST|length=760bp
TTTTTTTTTTTTTTGAGAAAATCTGGCAACTACCTACATTTTCCCCTTCC
TAGGCATGGCAAATTACTGATTCGGTCTACAAAAACTGGTGTTCAATCAA
AGAATCCTTAAGAACTCAAAAAGAAATGCTGAAGCAATTCATAGCTTCAT
GCTAGCAATGGAAGTATGTAACTAAAATGTAGAATAGGCAAAACAATAAA
ATAGTACCTATAAGGGTGCATTGCGAAGATATCTCCTCTCATAAAAACCA
GTCACTTGGTCAGCCACAGCCCACATAATGGCCTGGCCTGGCGGGATCCT
CATGAGACGGGGCAGCAGTCCTTTCCACAAGGCAAGAAGCCCCTCCTCAG
CATATATTGTTCTGATTGCATGGACCATGCCTTTGTACTTTAACTCACCC
CCACCTCGACTCTGGGCCATCAGCCTTGTCTTGACAACATCAAAAGGGCC
AGTGCATACTGGACCTGCTGTTCCTGCAAGGAATCCCGATATCATGGACT
GCCACGGTTGGAGGACCTTCCCATCACCTTCATGTTTCTTCCACAAGAGT
ACATCAAAAGCATTTTTAGCCGTAAACATGGCAGCTTGGTTTGTCCCATT
GCGCATAACAGTTGGGGCAGCCCCTGCCCAGAGTCCAAAGAGTCCTTCCT
CACGGATGATCATACGAGCACAGTGTATAGGACCCTTGTACTTTAGAAGC
TCAAGACTCAAACCTCTCTGCTGTTGTAGTCTAATTTTCACCACCTCAAA
AGGAGTAACA
back to top